RetrogeneDB ID:
retro_mputfur_420
Organism:
Location:
GL896908.1:10538100-10538946 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.73 %
Coverage:
98.29 %
Frameshifts:
5
Stop codons:
0


Parental gene:
Parental gene symbol:
PNP
Parental gene aliases:
No gene alias available
Parental gene description:
purine nucleoside phosphorylase [Source:HGNC Symbol;Acc:7892]

Genomic region (view in browser)





>retro_mputfur_420
GAGAATGAATTTACGTATGATGATGAAAGCACTAGCAAATGGCTTCTGCACCCCACCGAG
CACAGACCTCAAGTGGCGGTCCTCTGTGGTTCTGGGCTAGGAAATCTGGCTGATAAATTA
ACTGAGGCCCAAAGCTTTGTCTACAGTGAGATACCAAACTTTCCCCAAAATACAGTGCCG
AGTGCTGCTGGTCAGCTGGTGTTTGGGCTCCCGAATGGCAGAGCCTGTGTGATGGTGCAG
GACAGGTTTCCCACGCACGAAGCCTACTCGATCTTGAAGGTGACATTCCCAGTGAGGTTG
TTCTTCCTTATGGGTGTGGACACCCTAGTAGTCACCATTGCAGGGGGAGGACTCGACCCC
GAGTTTGAGGTTGGAGATACCATGCTGATCTGTGGTCAGGTCAACCTAACTGGCTTCAGT
GGTTTGAACCCTCTTAGAGGGCCCAAGGCTTGAAAGGTTTGGAGTTCGTGTCCCTGCCAT
GTCCGATGCCTATGAGGCAGAAGGCACACAGTGCCTGGAAACAGATGGGGAGCAGAGGGA
GCAAAAGGAAGGCACCTGCGAAAGGAAGGGCAGGCCTCACCTTCGAGCCTGTGGCAGCGC
GTTGGCTGCTGCGGAGCCGGGGGCAGATGCTGTTGGCATGAACACAGGTACCAGCAGTCG
AAGCTGGCAAGGCACTGTGGACTTCGAGTCTTTGGCTTCTCCCTCATCGCTAACAAAGTC
GTCCTGGATTATGACACCAAGAAGGTCAACCAGGAGGAAGTACTAGAGGTCGGGAAACAA
GCTACCCACAAATTGGAACAGTTTGTCTCCTTTCTTATGACCACTATTCTGCTGCCTGCC
AAAGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EKRFTYDDYQETSKWLLCQTKHRPQVAIICGSGLGNLANKLTETQSFDYSKIPNFPQSTVPGHAGRLVFGFLNGKACVVMQGRFHMYEGYSIWKVTFPVR
E..FTYDD...TSKWLL..T.HRPQVA..CGSGLGNLA.KLTE.QSF.YS.IPNFPQ.TVP..AG.LVFG..NG.ACV..Q.RF...E.YSI.KVTFPVR
Retrocopy
ENEFTYDD-ESTSKWLLHPTEHRPQVAVLCGSGLGNLADKLTEAQSFVYSEIPNFPQNTVPSAAGQLVFGLPNGRACVMVQDRFPTHEAYSILKVTFPVR


Parental protein
VFYLMGVDTLVVTNAAGGLNPEFEVGDIMLIRDHINLPGFSGVNPLMGPND-ERFGLRFPAMSNAYDRDMRQKAHSAWKQMGEQRELKEGTYVMLAGP-S
.F.LMGVDTLVVT.A.GGL.PEFEVGD.MLI....NL.GFSG.NPL.GP...ERFG.R.PAMS.AY.....Q.......Q....RE.KEGT......P..
Retrocopy
LFFLMGVDTLVVTIAGGGLDPEFEVGDTMLICGQVNLTGFSGLNPLRGPKA\ERFGVRVPAMSDAYEAEGTQCLETDGEQ----REQKEGTCERKGRP\T


Parental protein
FETVAECGLLQ-KLGADAVGMST-VPEV-IVARHCGLRVFGFSLITNKVILDYETKEKANHEEVLEAGRQAAEKLEQFVSVIMASIPPPAKA
FE.VA...LL....GADAVGM.T.VP.V...ARHCGLRVFGFSLI.NKV.LDY.TK.K.N.EEVLE.G.QA..KLEQFVS..M..I..PAKA
Retrocopy
FEPVAARWLLR/EPGADAVGMNT\VPAV\KLARHCGLRVFGFSLIANKVVLDYDTK-KVNQEEVLEVGKQATHKLEQFVSFLMTTILLPAKA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide