RetrogeneDB ID:
retro_mputfur_426
Organism:
Location:
GL896909.1:5927907-5928525 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.27 %
Coverage:
67.19 %
Frameshifts:
5
Stop codons:
0


Parental gene:
Parental gene symbol:
RPLP0
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein, large, P0 [Source:HGNC Symbol;Acc:10371]

Genomic region (view in browser)





>retro_mputfur_426
ATGCTCAGGGAAGACAAGGCAGGATGGAAGTCCACTAATTCCTTAAGATCATCCAACTTT
TGGATGATTATCCAAAATGCTTCATTGTGGAAGCACACAATGTAGGTTCCAAGCAGATGC
GGCATATTCTCATGTCCCTCCGGGGAAGGCTGTTGTGTTGATGGGCAAGAACACCGTGAT
GCACAAGCCCCCTCCAAAGGCACCTAGAGAACAACCAGCTCTGGAGAAACTGTTGCCTCA
CATCCGGGGGAATATGCGCTTTGTGCCCACCAAGGAGGACCTCACTGAGATCAGGGACAT
GCTGCCGGCCAGCAAGGTGCCAGCTCGTGCCATAGCCCTCTGTGAAGTCACTATGCCAGC
CCAGAACACTGGTCTAGGCCCAAGAAGTCTTCTATCTTCCAGGCTCTAGGCATCACCACG
GAAGTCTTCAAGGGCACCAGTGAAATCCTGACTGATAAGCAGCTGATTAAGACTGGAGAC
AAAGTGGGAGCCCGCAAACCACACTGCTGAACATGCTGAACATGTCCCCCCTTCTCCTGT
GAGCTGCTCATCCAGCTCGTGTTTGACAATGGCAAACACCCTGAAGTGCCCGACAACACT
GAGGAAACTGCATTCTCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPREDRATWKSNY-FLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRG-KAVVLMGKNTMMRKA-IRGHLENN-PALEKLLPHIRGNVGFVFTKEDLT
M.RED.A.WKS...FLKIIQLLDDYPKCFIV.A.NVGSKQM..I.MSLRG.KAVVLMGKNT.M.K.....HLENN.PALEKLLPHIRGN..FV.TKEDLT
Retrocopy
MLREDKAGWKSTN/FLKIIQLLDDYPKCFIVEAHNVGSKQMRHILMSLRG/KAVVLMGKNTVMHKP\LQRHLENN/PALEKLLPHIRGNMRFVPTKEDLT


Parental protein
EIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLG-PEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQVFDN
EIRDML.A.KVPA.A....IA.CEVT.PAQNTGLG.P.K.S.FQALGITT....GT.EIL.D.QLIKTGDKVGA............PFS..L.IQ.VFDN
Retrocopy
EIRDMLPASKVPARA----IALCEVTMPAQNTGLG/PKKSSIFQALGITTEVFKGTSEILTDKQLIKTGDKVGARKPHXXXXXXXPPFSCELLIQLVFDN


Parental protein
GSIYNPEVLDITEETLHS
G....PEV.D.TEET..S
Retrocopy
GK--HPEVPDNTEETAFS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide