RetrogeneDB ID:
retro_mputfur_427
Organism:
Location:
GL896909.1:7879892-7880553 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.75 %
Coverage:
50.57 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
EEF1G
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation elongation factor 1 gamma [Source:HGNC Symbol;Acc:3213]

Genomic region (view in browser)





>retro_mputfur_427
AGGACTTTTCTGTGGGCGAATGTGTGACACTGGCTGACATCACAGTTGTCTGCACCCTGT
TGTGGCTCTATAAAAAGGTCCTGGAGCCTTCTTTCCACCAGGCCTTCCCTGACACCAGCC
ACTGGATCCTCCCCTGCATTAACCAGCCCCAGTTTGGGGCTATCTTGGGGGAAGTGAAAC
TCTGTATGAGAAGATAGACCAGGTCGATGTTAAAATTTGCAGAGAGCCATCCTGAAAAGA
TTACTCCATGGAAAGAGAAGCGTTCTTGAGGAGAGAAGCAGAAGCCCCAGGCTGAGTGGA
AAGAGGAGAAAAAGACCGCTGTCCCTGCTCCTGAGGAGAAGATGGATGACTGTAAGCAGG
TGTTGACTATTGAGTCAAAGGCCGAGGATCCCTTTGCTCACCTGTCCAAGAATACCTTTG
TATTGGTTGAATTTAAGTGCAAATGATCCAATGAGGAAACCCTCTCTGTGGTGCTGCCCT
ATGTTTGGGAGCACTTTGCTAAGGATGGCTGGTCTCTGTGCTATTCTGAGGACTGCTTCC
CCGAGAGCTCACCCAGACCTTCATGAGCTGCAACCCCACCACTGGGCTGTTCTAGAGGTT
GGACAAACCAAGGAAGAATGTTTTTGCCTGTGTCACTCCCTTTGGAGCCAACAATCGCAG
C


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RTFL-VGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAESQPKKDTPRKEKGSREEKQKPQAE
RTFL.VGE.VTLADITVVCTLLWLYK.VLEPSF.QAFP.T..W.L.CINQPQF.A.LGEVKLC.........KFAES.P.K.TP.KEK.S..EKQKPQAE
Retrocopy
RTFL/VGECVTLADITVVCTLLWLYKKVLEPSFHQAFPDTSHWILPCINQPQFGAILGEVKLCMRR*TRSMLKFAESHPEKITPWKEKRS*GEKQKPQAE


Parental protein
RKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYAEYRFPE-ELTQTFMSCNLITGMF
.KEEKK.A.PAPEE.MD.C.Q.L..E.KA.DPFAHL.K.TFVL.EFK.K.SNE.TLSV.LPY.WEHF.KDGWSL.Y.E..FPE.ELTQTFMSCN..TG.F
Retrocopy
WKEEKKTAVPAPEEKMDDCKQVLTIESKAEDPFAHLSKNTFVLVEFKCK*SNEETLSVVLPYVWEHFAKDGWSLCYSEDCFPE/ELTQTFMSCNPTTGLF


Parental protein
QRLDKLRKNAFASVILFGTNNSS
.RLDK.RKN.FA.V..FG.NN.S
Retrocopy
*RLDKPRKNVFACVTPFGANNRS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide