RetrogeneDB ID:
retro_mputfur_429
Organism:
Location:
GL896909.1:15441493-15441807 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.04 %
Coverage:
51.24 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
Pttg1
Parental gene aliases:
No gene alias available
Parental gene description:
pituitary tumor-transforming gene 1 [Source:MGI Symbol;Acc:MGI:1353578]

Genomic region (view in browser)





>retro_mputfur_429
AAAGCAAAAAGCTCTGTTCCTGCCTTGGATGATGCTGATCCAGAAATTGAAAAATTCATT
CCCTTAAATCCCCTAGATTTTGAGAGTTTTGACCTGACTGAAGAATATGAGATGGCACAG
CTCCCCTTGAATAGAGTGCCTCCCATGAGCCTTGATGAGAAAAGGAAACTTGAAAAACTG
TTACACCTGGCTCCTCTTCCCCTCCAAAAATGCCCTCCACAGTGATGTGGAAGTAGAATC
TGCTGTAGCCTCCTTCAAGCATTCTGTGGGCTCTGGATGTCAAATTGGCACCCCCTTGTT
ATAAGTTAAATATT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KAKSSVPASDDTYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLNGVPLMILDEERELEKLLHLGP-PSPLKIPSP-PWESNLLQSP-SVLSTLDVELPPV
KAKSSVPA.DD..PEIEKF.P.NPLDFESFDL.EE...A.LPLN.VP.M.LDE.R.LEKLLHL.P..SP.K.PS...W..NLL..P.S.L..LDV.L.P.
Retrocopy
KAKSSVPALDDADPEIEKFIPLNPLDFESFDLTEEYEMAQLPLNRVPPMSLDEKRKLEKLLHLAP/SSPPKMPSTVMWK*NLL*PPSSILWALDVKLAPP


Parental protein
CYDLDI
CY.L.I
Retrocopy
CYKLNI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide