RetrogeneDB ID:
retro_mputfur_430
Organism:
Location:
GL896909.1:17392044-17392527 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
51.76 %
Coverage:
52.83 %
Frameshifts:
2
Stop codons:
6


Parental gene:
Parental gene symbol:
PRPS1
Parental gene aliases:
No gene alias available
Parental gene description:
phosphoribosyl pyrophosphate synthetase 1 [Source:HGNC Symbol;Acc:9462]

Genomic region (view in browser)





>retro_mputfur_430
ATGCCAAATATCAAAACCTCTAGCTGCAGCTCATCCCATGATTCATCTCAGAAAATTGCC
TAACCTTTGGGAATGGAATTAGGCAAAGTGTTAACTGAAAAATCCAGCAACTAAGAGACA
AGTGTGGAGATTGGGAAGAGTGTGCATAGACAGCAAGATGTTTACATTGCTCAGTGGTTG
AGGCAATCTATTGGAGCTTCTAATCATGATTAATATCTGCACAATTGCTGTAGCCAACTC
CATTTGTCCCCACTTCCCCTAGACCTGGTAGAACAAGAAAACTAAGAGTCGAGCCCCAAT
CTTGACCAAACTCATTACAAATATGTTATGCATGGCAGACCCTGGTCATTCCATCTTCAT
GATATACATGTTTTCTAAGATTTAGAGTTTACTGGTGTTCCAGTGAGTAACTTGTATGTG
CAGCCAGCTATCCTAAAGTGGATGAAAAATAGTATCTCTGAGTGGAGGAATTATTTTCTC
ATT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGED-VYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDK
MPNIK..S.SS..D.SQKIA..LG.ELGKV.T.K.SN.ET.VEIG.SV..........SG.G....NL.ELLIMIN.C.IA.A.......P.FP.....K
Retrocopy
MPNIKTSSCSSSHDSSQKIA*PLGMELGKVLTEKSSN*ETSVEIGKSVHRQQ\MFTLLSG*G----NLLELLIMINICTIAVAN---SICPHFP*TW*NK


Parental protein
KDKSRAPISAKLVANMLSVAGADHIITM-DLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIV
K.KSRAPI..KL..NML..A...H.I.M.D.H......F...PV.NLY..PA.LKW....ISEWRN....
Retrocopy
KTKSRAPILTKLITNMLCMADPGHSIFM/DIHVF*DLEFTGVPVSNLYVQPAILKWMKNSISEWRNYFLI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide