RetrogeneDB ID:
retro_mputfur_434
Organism:
Location:
GL896909.1:8303841-8304856 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
69.34 %
Coverage:
59.3 %
Frameshifts:
8
Stop codons:
3


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Heat shock 60kDa protein 1 [Source:UniProtKB/TrEMBL;Acc:G9K4Y8]

Genomic region (view in browser)





>retro_mputfur_434
AAAAGTCAGAAATGTAAATTCCAAGATGCCTATGTTCTACCAAGTGAAAAGAAAATTCCT
AGTGTCCAGTCCATTGTACTTGCTCTTGAAACTGCCAATGCTCATCTTAAGCCCTTGGTC
ATAACTGCCAAAGATACTGATGGAGAAGCTCTGAGTACACAGGTTCTGAATAGGTCAAAA
GTTGGGTTTTCAGGTTGTAGCAGTCAAAGCTCCAGATTTTGGTGACAATACAAAGAACTA
GCTTAAAGATGTGGCTGTTGCTACTGACGGTGCAATGTTTGCAGAAGAAGGATCAACTTT
GAATCTTAAAGATGTTTAACCTCACAACTTGGGAAAATTTGGAGAGGTCACTGTGGCCAA
AAATGATGCCATGCTTTTAAAGGAAAAGATGACAAGGCCCAAACCGAGAAACGTATTCAA
GAAATCATTGAGCAGTTAGATATGACAACCAGGAAAAGGAAAAGCTGAATGAACATCTGG
CAAACTCTCAGATGGAGTAGCTGGGCTGAAGAGCGGTGAGAAAAGTGGTAAGAAAGTGCA
TGAAAAGACAGGGAGGGTTGCAGGTGCCCTCAGAGCCATCAGTAGCTGCTGTTGAAGCAG
GCAGTGTTCTGGGAAGGGGGTTGTGCCCTGCTTTGGCACATTCCAGCTTTGGATTCAATA
ACTCCACCTAATGAAGATCCAAAACTTGGTACAGAAATTATGAAGCAGACACTCGAAATT
CCTGTAATAAGCACTGCTAAGAATTCAGGTGTTGAAAGAGCACTGACAGTTGAGAAAATT
ACGTGAAGTTCCTCAGAAGTTGGTTATGACACCATGTTTGAGACTCTGTGAATATGGTAG
AAAAAGGAACCACTGATCCAACCAAGACTGTGAGAACTGTTTTACTGAATGCAGCTGAGG
TGGCCTCTCTGTTAACTACAGCAGAAGTTGTAATCACAGGAGTTCTTCAAGAAGGAAAGG
GCCCTGGAATGGTGCAATGAGTGGAGGAAGAGGTGGTGTGGGAGGAGGCAGGTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGL-QVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLT
K.QKC.FQDAYVL.SEKKI.SVQSIV.ALE.ANAH.KPLVI.A.D.DGEALST.VLNR.KVG..QVVAVKAP.FGDN.KN.LKD.A.AT.GA.F.EEG.T
Retrocopy
KSQKCKFQDAYVLPSEKKIPSVQSIVLALETANAHLKPLVITAKDTDGEALSTQVLNRSKVGF\QVVAVKAPDFGDNTKN*LKDVAVATDGAMFAEEGST


Parental protein
LNLEDVQPHDLGKVGEVIVTKDDAMLL-KGKGDKAQIEKRIQEIIEQLDITT-SEYEKEKLNERLA-KLSDGVAVLKVGGTSDVEVNEKKDRVTDALNA-
LNL.DV.PH.LGK.GEV.V.K.DAMLL.KGK.DKAQ.EKRIQEIIEQLD.TT..E.EK..LNE.LA.KLSDGVA.LK.G..S...V.EK..RV..AL.A.
Retrocopy
LNLKDV*PHNLGKFGEVTVAKNDAMLL/KGKDDKAQTEKRIQEIIEQLDMTT/QEKEK--LNEHLA/KLSDGVAGLKSGEKSGKKVHEKTGRVAGALRA\


Parental protein
TRAAVEEGIVLG-GGCALLRCIPALDSLTPTNEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQSSPEVGYDAMLG-DFVNMVEKGIIDPTKVV
..AAVE.G.VLG.GGCALL..IPALDS.TP.NED.K.G.EI.K.TL.IP....AKN.GVE..L.VEKI..SS.EVGYD.M...D.VNMVEKG..DPTK.V
Retrocopy
SVAAVEAGSVLG\GGCALLWHIPALDSITPPNEDPKLGTEIMKQTLEIPVISTAKNSGVERALTVEKIT*SSSEVGYDTMFE/DSVNMVEKGTTDPTKTV


Parental protein
RTALLDAAGVASLLTTAEVVVTEIPKEEKDPAM-GGMGGMGGGMGGGMF
RT.LL.AA.VASLLTTAEVV.T....E.K.P.M.G.M.G..GG.GGG.F
Retrocopy
RTVLLNAAEVASLLTTAEVVITGVLQEGKGPGM/GAMSGGRGGVGGGRF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide