RetrogeneDB ID:
retro_mputfur_437
Organism:
Location:
GL896909.1:16408831-16409514 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.12 %
Coverage:
53.5 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
MRPS30
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein S30 [Source:HGNC Symbol;Acc:8769]

Genomic region (view in browser)





>retro_mputfur_437
CCAGTCCAATTTTACTGGTTGTGAGGTGAATAAATTCTTTCTAGTAGTCATCAGAAAGGT
TGCGTTGATGCTGTGTGATACCAAATAAATGATAAATCACACAACCAGATTCAAATATCC
AAACAACTCCCAGAGTTTGTGCCACTGAATTATTCTATACCTGTCAAAATCCCTGTTATA
ACTTGTAAGCCAGACAAACTTCCATTATTCAAATGACAATATGAATATAACATATTTATT
GGCTCAAAGACAGCAGATCCATACTGCTATGGTCACACACAGTTTCACCTGTTACCTGAC
AAATTAAAAATGGAAAGGCTTTTTGAAATGGAACTGTGTTGATCAGATAGAAGTTATTTT
TAGAGCTAATGCTATTGCAAGCCTCTTTGCTTGGACTGGAGCACAAGCTCTGTATCAAGG
ATTTTGGAGTGAAGCAGATGTTACTCAGCCTTTTGTCCCTCATGGCATGATCACAGATGG
AAAATACTTTTCCTTTTTCTGCTACCAGTTAAATACTTTGGCATTGACTACACAAGGGGA
TCAAAATAACCCTCCTAAAAATATATGTTGGGGGACACAAAGTAAGCCTCTTTATGAAAC
AACTGAAGATAATGTGAAAGGTTTTAATGATGATGTCCTCCAGATAGTTCATTTTCTACT
AAACAGACCAAAAAGAAGACAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PVHFYWLRGEEIISKGHRKGRVDALRYQINDKPHNQIRISKQLPEFVPLDYSVPVDIPVITCKPDKLPLFRRQYENTVFIGSKTADPYCYGHTQFHLLPD
PV.FYWL.GE.I.S..H.KG.VDA..YQINDK.HNQI.ISKQLPEFVPL.YS.PV.IPVITCKPDKLPLF..QYE...FIGSKTADPYCYGHTQFHLLPD
Retrocopy
PVQFYWL*GE*ILSSSHQKGCVDAV*YQINDKSHNQIQISKQLPEFVPLNYSIPVKIPVITCKPDKLPLFK*QYEYNIFIGSKTADPYCYGHTQFHLLPD


Parental protein
KLKRERL-LKRNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQGVITDGRYFSFFCYQLNTLALTAQADQNNPRKNICWGTQSTPLYE
KLK.ERL.LK.NC.DQIEV.FRANAIASLFAWTGAQA.YQGFWSEADVT.PFV..G.ITDG.YFSFFCYQLNTLALT.Q.DQNNP.KNICWGTQS.PLYE
Retrocopy
KLKMERL\LKWNCVDQIEVIFRANAIASLFAWTGAQALYQGFWSEADVTQPFVPHGMITDGKYFSFFCYQLNTLALTTQGDQNNPPKNICWGTQSKPLYE


Parental protein
TIEDNNVKGFNDDVLLQIVHFLLNRP-KEDK
T.ED.NVKGFNDDV.LQIVHFLLNRP.KEDK
Retrocopy
TTED-NVKGFNDDV-LQIVHFLLNRP\KEDK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide