RetrogeneDB ID:
retro_mputfur_438
Organism:
Location:
GL896909.1:18185024-18185281 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.04 %
Coverage:
98.85 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
DBI
Parental gene aliases:
No gene alias available
Parental gene description:
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Source:HGNC Symbol;Acc:2690]

Genomic region (view in browser)





>retro_mputfur_438
ATGGCTCAGGTTGAGTCTGACAAAGCTGCTGAGGATGCTGAGACCTCAAAACCGAGCCAA
CAGATGATGAGATGCCCTTCACCTACAGCCACTAAGAGCCAGCCACTGTGGGTGACACAA
AACACAGAGCAGCCTGGGCTGCTGGATCTCAAAGTCAGACCAAGCAGGATGCCTGCAATC
AGCTGAAAGGGGCTTTCAGGGAAGAATCTTTGAAAGCTTGCATCAACAAAGTAGAAGATC
TGAAGAAAAAGTATGGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSQAEFDKAAEDVK-HLKTKPTDDEMLFIYGHYKQVTVGDV-NTERPGLLDLK-GKAKWDAWNQLKGTSKEDAMKAYINKVEELKKKYG
M.Q.E.DKAAED....LKT.PTDDEM.F.Y.H....TVGD..NTE.PGLLDLK....K.DA.NQLKG...E...KA.INKVE.LKKKYG
Retrocopy
MAQVESDKAAEDAE/DLKTEPTDDEMPFTYSH*EPATVGDT\NTEQPGLLDLK/SQTKQDACNQLKGAFREESLKACINKVEDLKKKYG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide