RetrogeneDB ID:
retro_mputfur_44
Organism:
Location:
GL897083.1:565803-566661 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.74 %
Coverage:
73.43 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
C16orf72
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 16 open reading frame 72 [Source:HGNC Symbol;Acc:30103]

Genomic region (view in browser)





>retro_mputfur_44
ATGGAGGAGCAGCCGAAGGAGGGCGAGGCCGAGGTGGCGGAGCACTGGTTTTCCAAGTGG
GAACGCCAGTGCCTGGCCGAGGCCGAGCAGGGGGAGCAGCTGCCCCCCGAGCTGCAGGAG
GAGGCGGCCGCGGAGGCAGCGGGGCTCAAGAGCGAGCGGCAGAGGCTGTGGCACCTCTTC
CAGATCTCTGCCACCGCCGTGGCCCAGCTCTACAAGGATGCCGGGTGCCAACAGCCAGAT
CTGTCCATCTGGGACCCCTTCCAGAACGCGGCCATGGCCGTGACCAGTCTCTACAAAGAG
AGCGGGGATGCCCACCAACGAAGTTTTGACCTGGGCGTCCAGGTCGGCTACCAGCGTCGC
ATCAGAGATGTCCTGGAGTGGGTGAAGAAGGGCCGGAGCACCATTCTCCGCGAAGACCTG
ATCAGCTTCCTGTGTGGCAAGGTGCCCCCCGCACCTCCACCGTCGCGCACCCCCAGGACG
CCGCCGAAGCTGTCTGTCGCGGCCTCCGGCCAGGCCGCAGCCACCGGGGCCGGATCGTCC
GTAGACGTCGACCTGCAGCCCTTCCATGAGGCCATCGCCCTGCATGGCCTCAGTGGTGCC
ATGGCGAGCATCAGCGTGAGATCTGGCGCCCCTGGCTCCCCGCCTCAAGCCAGCGGCGGG
GCCACCAATGGCGTCCCCACCAGTAGCCCTGGAGGTGGGCGCCGAAAAAGTAGCTTCCTG
GAGGACGACTTGAACCCCTTCAACTCAGAAGAACCGGCCCTCCGCCTGGACAGTGGGGGG
ACCCGCAAGCGCACCTCGGCCCAGTGCGGGGATAGTGTCACAGACTCCCCCACCCACAAG
CGCAACCGAATGGTCTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SLSSAFSDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRREDLISFLCGKVPP----PRNSRAPPRLT
.......D..CQQP.LS.W.PFQNAA.AVT.LYKES.D.HQRSFD.G.Q.GYQRR..DVL.WVKK.R.TI.REDLISFLCGKVPP.....R..R.PP.L.
Retrocopy
AVAQLYKDAGCQQPDLSIWDPFQNAAMAVTSLYKESGDAHQRSFDLGVQVGYQRRIRDVLEWVKKGRSTILREDLISFLCGKVPPAPPPSRTPRTPPKLS


Parental protein
VVSPNRATSTETSSSVETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGS
V.....A..T...SSV..DLQPF.EAIALHGLSGAMASISVRS..PGSP...S.G.
Retrocopy
VAASGQAAATGAGSSVDVDLQPFHEAIALHGLSGAMASISVRSGAPGSPPQASGGA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide