RetrogeneDB ID:
retro_mputfur_442
Organism:
Location:
GL896910.1:851529-851988 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
93.46 %
Coverage:
91.07 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
NME1
Parental gene aliases:
No gene alias available
Parental gene description:
NME/NM23 nucleoside diphosphate kinase 1 [Source:HGNC Symbol;Acc:7849]

Genomic region (view in browser)





>retro_mputfur_442
ACCATGGCCAACTGTGAACGCACCTTCATTGCCATCAAGCCCGATGGGGTCCAGCGCAGC
CTCGTGGGAGAAATCACCAAGCGTTTGGAGCAAAAGGGATTCCACCTCGTTGCTATGAAA
TTAATTCAGGCTTCTGAAGACCTTCTCAAGGAGCACTACATCGACCTGAAGGACCGTCCC
TTCTTTACCGGCTTGGTCAAGTACATGCAGTCAGGGCCCGTGGTTGCCATGGTCTGGGAG
GGCCTGAATGTGGTGAAGACAGGCCAAGTGATGCTTGGGGAGACCAACCCTGCAGACTCC
AAGCCTGGGACCAGCCGTGGGGACTTCTGGATCCAAGTTGGCAGGCACATTATCCACGGC
AGCGACTCCATGGAGAGTGCGGAAAAGGAGATTGGCTTGTGGTTCCAGCCTGAAGAGCTG
GTGGATTACAAGAGCTGTGCTCAGAGCTGGATCTACGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TMASCERTFIAIKPDGVQRSLVGEIIKRFEQKGFRLVAMKLIQASEDLLKEHYIDLKDRPFFAGLVKYMQSGPVVAMVWEGLNVVKTGRVMLGETNPADS
TMA.CERTFIAIKPDGVQRSLVGEI.KR.EQKGF.LVAMKLIQASEDLLKEHYIDLKDRPFF.GLVKYMQSGPVVAMVWEGLNVVKTG.VMLGETNPADS
Retrocopy
TMANCERTFIAIKPDGVQRSLVGEITKRLEQKGFHLVAMKLIQASEDLLKEHYIDLKDRPFFTGLVKYMQSGPVVAMVWEGLNVVKTGQVMLGETNPADS


Parental protein
KPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFQPEELVDYKSCAQSWIYE
KPGT.RGDF.IQVGR.IIHGSDS.ESAEKEIGLWFQPEELVDYKSCAQSWIYE
Retrocopy
KPGTSRGDFWIQVGRHIIHGSDSMESAEKEIGLWFQPEELVDYKSCAQSWIYE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide