RetrogeneDB ID:
retro_mputfur_447
Organism:
Location:
GL896910.1:856971-857338 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
60.98 %
Coverage:
75.16 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
RPS16
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S16 [Source:HGNC Symbol;Acc:10396]

Genomic region (view in browser)





>retro_mputfur_447
TGCAGATGGGGCAGCAGCCTTATCCAGCTGAATGGGCAGCCTCTGGAGATGATCCAGCAG
TGCACACAGCAGTACAAGCTACTGGAATCTGTTCTGCTTCTGGGCAGGGAATGATTTCTT
GGGGTGGGCATCTGAGTCTGTGTGAAGGGTAGTGGTCATGGGACCCAGATTTGCACAGTC
TGCTAGCACAACTCCAAAGCCCTGGGGTCCTTATTATCAGAAATACATAGATGAGACTTC
CGAGAAGGAGCTCAAAGCCATTTTCATTCAGTATGACCAAACCCTGCTGGGGGTAGCTGA
TCCCTGTGTCAGTGAATTCAAAAAGTTTGGGGGCCCTGGTGTTCATACTTGCTACCAGAA
ATTCTAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
CKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVA-YYQKYVDEASKKEIKDILIQYDRTLL-VA
C..G..LI..NG.PLEMI...T.QYKLLE.VLLLG.E.F.GV.I.V.VKG.GH..QI.......SKAL...YYQKY.DE.S.KE.K.I.IQYD.TLL.VA
Retrocopy
CRWGSSLIQLNGQPLEMIQQCTQQYKLLESVLLLGRE*FLGVGI*VCVKGSGHGTQICTVC*HNSKALGS\YYQKYIDETSEKELKAIFIQYDQTLLGVA


Parental protein
DPRRCESKKFGGPGARARYQKSY
DP...E.KKFGGPG....YQK.Y
Retrocopy
DPCVSEFKKFGGPGVHTCYQKFY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide