RetrogeneDB ID:
retro_mputfur_450
Organism:
Location:
GL896910.1:9839459-9840274 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.41 %
Coverage:
77.94 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
ST13
Parental gene aliases:
No gene alias available
Parental gene description:
suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) [Source:HGNC Symbol;Acc:11343]

Genomic region (view in browser)





>retro_mputfur_450
AGTACCTGCGCCTGGAATCGGGTGGCAACCTCAGCTGCGCCTGCCGCTGCTACTGTCTCT
GGACCATGGACCCCCGCAAAGTGAGCGAGCTTCGGGCTTTCGTGAAAATGGGTAAGCAGG
ATCCAAGCGTTCTGCACACCGAGGAAATGCGTTTCCTGCGGGAGTGGGTGGAGACCATGG
GGGGTAAAATACCACCTGCCACTCATAAAACTAAATCAGAAGACAGTATCAAGGAAGAAA
AACCAGATAGTAAGAAGGCGGAGGAAAACATAAAGACAGATGAACCGTCAAGTGAGGAGA
GTGATCTAGAAATTGACAATGAAGGTGTGATTGAACCAGATACCAATGCCCCTCAAGAAA
TGGGAGATGAAAATGTAGAGATAACCGAGGAAATGATGGATCAGGCAAATGATAAAAAAG
TGGCTGCCATTGATGCCCTAAATGATGGTGAACTACAGAAAGCCACTGACTTGTTCACAG
ATGCCATCAAACTACATCCTCGCTTGGCCATTCTGTATGCCAAGAGAGCCAGTGTCTTCA
TCAAATTACAGAAGCCAAATGCTGCCATTCGAGACTGTGACAGAGCTATTGAAATAAATC
CTGATTCAGCTCAGCCTTATAAGTGGTGAGGAAAAGCACATAGACTCCTGGGCCATTGGG
AAGAAACAGCACATGATCTTGCCCTTGCTTGTAAACTGGATTAGGATGGAGATGCTAGTG
TAATGCTGAAAGAAGTTCAACTGAGGGCCCAGAAAATTGCTGAACATCGGAGAAAATATG
AGCGAAAACGTGAAGAGTGAGAGATCAAAGAAAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
STRAWNRVATPAALAA-CHCLWTMDPRKVSELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKIPPATHKTKSEDSIKEEKPDSKKAEENIKTDEPSSE
ST.AWNRVAT.AA.AA.C.CLWTMDPRKVSELRAFVKM.KQDPSVLHTEEMRFLREWVE.MGGKIPPATHKTKSEDSIKEEKPDSKKAEENIKTDEPSSE
Retrocopy
STCAWNRVATSAAPAA/CYCLWTMDPRKVSELRAFVKMGKQDPSVLHTEEMRFLREWVETMGGKIPPATHKTKSEDSIKEEKPDSKKAEENIKTDEPSSE


Parental protein
ESDLEIDNEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFIKLQKPNAAIRDCDRAIEI
ESDLEIDNEGVIEPDT.APQEMGDEN.EITEEMMDQANDKKVAAIDALNDGELQKA.DLFTDAIKL.PRLAILYAKRASVFIKLQKPNAAIRDCDRAIEI
Retrocopy
ESDLEIDNEGVIEPDTNAPQEMGDENVEITEEMMDQANDKKVAAIDALNDGELQKATDLFTDAIKLHPRLAILYAKRASVFIKLQKPNAAIRDCDRAIEI


Parental protein
NPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYERKREEREIKER
NPDSAQPYKW.GKAHRLLGHWEE.AHDLALACKLD.D.DAS.MLKEVQ.RAQKIAEHRRKYERKREE.EIKER
Retrocopy
NPDSAQPYKW*GKAHRLLGHWEETAHDLALACKLD*DGDASVMLKEVQLRAQKIAEHRRKYERKREE*EIKER


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide