RetrogeneDB ID:
retro_mputfur_451
Organism:
Location:
GL896910.1:10772390-10772980 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
76.47 %
Coverage:
68.58 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
Rpl5
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L5 [Source:MGI Symbol;Acc:MGI:102854]

Genomic region (view in browser)





>retro_mputfur_451
AGAAGATGAGAGGGTATAATTGATTATTATGCTCAGAAACACTTGGTAATTTAGGATAAA
AATAAGTACAACACATCCAAATATAGAATGATAGTTCAAGTAGCTAACAGAAGGATCATT
TGTCAGATTGCTTATGCCACTATAGAAGGAGATATGATTGTTTTTGCAGCTTATGCTCAT
GAACTTCCAAAGTACAGTGTGAAGGCTGGCTTGACAAATTACGCTACAGCATATTGTACT
GGTCTGCTACTGGCCTTTAGTAGGTTTGGCTTAGACAAGATCTGTGAAGGCCAGGTGGAG
GTGACTAGAGATGAATACAATGTGGAAAGCATTGACGGTCAACCTGGTGTCTTCACCTGC
TTTTTGGATGCAGGGCTGGCCACAACTGCTACTGGAAATAAAGTTTTTGTGGCCCTCAAG
GGACCTGCGGATGGAGGCTTGCTGTCCCTCATAGTACCAAATGATTCCCTGGTTTGGAAA
GCAAGGAATTTAGTGCAGAAGTACATGGGAAGCATATGGGTCAGAACATTGCAGATTATA
TGCATTACCAAATAGAAGATAATGAAGATGCTGACATGAAACAATTCTCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEG
RR.EG..DYYA.K.LVI.DKNKYNT.KYRMIV.V.NR.IICQIAYA.IEGDMIV.AAYAHELPKY.VK.GLTNYA.AYCTGLLLA.....RFG.DKI.EG
Retrocopy
RR*EGIIDYYAQKHLVI*DKNKYNTSKYRMIVQVANRRIICQIAYATIEGDMIVFAAYAHELPKYSVKAGLTNYATAYCTGLLLA---FSRFGLDKICEG


Parental protein
QVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGG-LSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYK
QVEVT.DEYNVESIDGQPG.FTC.LDAGLA.T.TGNKVF.ALKG..DGG.L..PHSTK.FPG...ESKEF.AEVH.KH.MGQN.ADYM.Y..E..EDA..
Retrocopy
QVEVTRDEYNVESIDGQPGVFTCFLDAGLATTATGNKVFVALKGPADGG/LAVPHSTK*FPGL--ESKEFSAEVHGKH-MGQNIADYMHYQIEDNEDADM


Parental protein
KQFS
KQFS
Retrocopy
KQFS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide