RetrogeneDB ID:
retro_mputfur_453
Organism:
Location:
GL896910.1:17580745-17581003 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
54.26 %
Coverage:
73.6 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
CNEP1R1
Parental gene aliases:
No gene alias available
Parental gene description:
CTD nuclear envelope phosphatase 1 regulatory subunit 1 [Source:HGNC Symbol;Acc:26759]

Genomic region (view in browser)





>retro_mputfur_453
CTAGAGCAAGCAGAAAGTTTTGAAAGACTTTCTTAATATATTCATCACTTGCAACCTGCC
CCAGGCCATTGGAGAATGCTGCCCATGGAGGTTCCTGTCTGTACAGGTGCCTGGAAGTAG
TTAAAAGATCCCAAGACACTAAAGGGTCCTTCTTCACATCTCTGTGGCACATCCCCTTTT
TCACAATTAGTTATTTACCTCTAATGGCTTTTTTTTTTTTGCGGGATACCCCACAGACTA
GCGGCACCATCAGTTATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPET-QKVSFFTSLWNHPFFTISCITLI-GLFFAGIHKRVVAPSII
LEQAE.......RL..YIH.LQPA.G.WRML...V.VCT..GAW..L.DP.T..K.SFFTSLW..PFFTIS...L.......GI..R..APS..
Retrocopy
LEQAESFE----RLS*YIHHLQPAPGHWRMLPMEVPVCT--GAWK*LKDPKT/TKGSFFTSLWHIPFFTISYLPLM\XXXXXGIPHRLAAPSVM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide