RetrogeneDB ID:
retro_mputfur_455
Organism:
Location:
GL896910.1:19597719-19597985 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
64.13 %
Coverage:
55.28 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
LAMTOR1
Parental gene aliases:
No gene alias available
Parental gene description:
late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 [Source:HGNC Symbol;Acc:26068]

Genomic region (view in browser)





>retro_mputfur_455
GGGTGTTGCTACAGCGGCGAGAAGAGGGACATGAACCAGGACCTAGAGGAGCGGAAGCTG
CTGCAGGACCCTAACGGCCCCCTACCAAAGCCCTCAGTGGAGCTGAGCCCAACCACAGCT
GGCCTTCCACTGGCTCGCACAGAAGAGGGGGCCCTGCTCTCCCCCTGCCTTACTAAGACA
GCAACAACATCACCAGAGCGTCTGCTGCAGACTGCCAGGGCATGGAGCAGCACAAGCACA
GGGACCCAGCACGGCAGGACAGCACC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GCCYSSENEDSDQDREERKLLLDPSS-PPTKALNGAEPNYH-SLPPTRTDEQALLSSILAKTA-SNIIDVSAADSQGMEQHEYMDRARQYST
GCCYS.E..D..QD.EERKLL.DP...PPTKAL.GAEPN....LP..RT.E.ALLS..L.KTA..NI...SAAD.QGMEQH...D.ARQ.ST
Retrocopy
GCCYSGEKRDMNQDLEERKLLQDPNG/PPTKALSGAEPNHS\GLPLARTEEGALLSPCLTKTA/NNITRASAADCQGMEQHKHRDPARQDST


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide