RetrogeneDB ID:
retro_mputfur_456
Organism:
Location:
GL896910.1:20076913-20077494 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
64.82 %
Coverage:
75.1 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
EMC3
Parental gene aliases:
No gene alias available
Parental gene description:
ER membrane protein complex subunit 3 [Source:HGNC Symbol;Acc:23999]

Genomic region (view in browser)





>retro_mputfur_456
GAGCTGCAGCTCGACTCCAATGTGAGTCTCTAGTGGCCCTGTCCATGTTCACCATCACCG
GCTCTGTGGGCATGATCCACCACCATGTGTCCATCCTGCTGCAGAGTGACAAGAAACTCA
CCCAAGAGCAAGTATTTGACAGCTAAAGTCCTATTACATAGCACAGTCCTCAGGGAAAAT
GGAAGTATTCCCAAACAGTCCTTCTTGACATGAAAATATTACTTCCAAGACCACAAAGGA
CAGATTTTTCAAAAAACTAAAGAGAAAACAGTACTACCTTCTCTTATGACTGATTCCACT
ATGCTCACAGACATGGTGAAAGGGAATTTAACAAATGTCATCCCAATCATTCTGACTAGT
GAATGGATAAACATGACCTGCTCAGGCTTTGTTACAACCAAAGGCCTATTTCTACTGATG
CTGTTTTTTAAGCCTATGCTATAGGAAGGAATTCAACTACTCACATTAGCTGCATCTGAG
TACATGCTACATCCTGGTAATTCTACGTATTTGGAATTCAGAGCATTTATTCTTTCATTC
TGGGCCAAAATGAAGCCAATGACCAACCAAGAACAATCCAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ELLLDSNIRL-WVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDS-QVLIRSRVLRENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMT
EL.LDSN..L..V.L....IT..VGMI.H.VSILLQSDKKLTQEQV.DS..VL..S.VLRENG..IPKQSFLT.KYYF.......F.KTK.K.V.PS.MT
Retrocopy
ELQLDSNVSL/LVALSMFTITGSVGMIHHHVSILLQSDKKLTQEQVFDS\KVLLHSTVLRENGS-IPKQSFLT*KYYFQDHKGQIFQKTKEKTVLPSLMT


Parental protein
DPTMLTDMMKGNVTNVLPMILIGGWINMTFSGFVTTKVPFPLTLRFKPMLQQGIELLTLDASW-VSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQ
D.TMLTDM.KGN.TNV.P.IL...WINMT.SGFVTTK..F.L.L.FKPML..GI.LLTL.AS..V...SW.F..VFG..SIYS.ILGQ..A.DQ.R..Q
Retrocopy
DSTMLTDMVKGNLTNVIPIILTSEWINMTCSGFVTTKGLFLLMLFFKPML*EGIQLLTLAASE/VHATSW*FY-VFGIQSIYSFILGQNEANDQPRTIQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide