RetrogeneDB ID:
retro_mputfur_458
Organism:
Location:
GL896911.1:304564-305130 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.11 %
Coverage:
96.92 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
TAF12
Parental gene aliases:
No gene alias available
Parental gene description:
TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa [Source:HGNC Symbol;Acc:11545]

Genomic region (view in browser)





>retro_mputfur_458
CTGATTGGCCTTGGTCCTCATAGCTCCAAAAAGAATCAGGACCTCGATAAGGTCTATGAG
CTGAAGTCCAAAGCTCGACAGATTATGAACCAGTTTGGCCCCTCAGCCTTAATCAACCTC
TGCAATTTCTCATCCATAAAACCGGAACCAGCCAGCACCCCTCCACTAGGCTCCATGGCC
AATAGCACCACAGTGGTAAAGATACCAGGCACTCCTGGGACAGGAGGGCGTCTCGGCCCT
GAAAACAATCAGGTATTGATCAAGAAGAAATTACAAGACTTAGTAAGAGAAGTGAATCCT
AATGAGCAATTGGATGAAGATGTGGAAGAGATGCTGCTGCAGATTGCTGATGATTTTATC
AAGAGGGTGGTGACGGCAGCCTGACAGCTCGCTCGGCATCGCAAGTCCAGCACCCCGGAG
GTGAAGGATGTCCAGCTGCATCTAGAATGCCAGTGGAACATGTGGATCCCAGGATTTGGC
TCTGAAGAAATCTGACCCTACAAAAAGGCTTGCACCCAGAGGCCCACAAACAGCGAATGG
CATTGATCCGGAAAACAACCAAGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LIGLGPHSSKKKQDLDKLYELKSKARQIMNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTTVVKIPGTPGTGGRLSPENNQVLTKKKLQDLVREVDP
LIGLGPHSSKK.QDLDK.YELKSKARQIMNQFGPSALINL.NFSSIKPEPASTPP.GSMANSTTVVKIPGTPGTGGRL.PENNQVL.KKKLQDLVREV.P
Retrocopy
LIGLGPHSSKKNQDLDKVYELKSKARQIMNQFGPSALINLCNFSSIKPEPASTPPLGSMANSTTVVKIPGTPGTGGRLGPENNQVLIKKKLQDLVREVNP


Parental protein
NEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACT-TEAHKQRMALIRKTTKK
NEQLDEDVEEMLLQIADDFI..VVTAA.QLARHRKSST.EVKDVQLHLE.QWNMWIPGFGSEEI.PYKKACT..EAHKQRMALIRKTTKK
Retrocopy
NEQLDEDVEEMLLQIADDFIKRVVTAA*QLARHRKSSTPEVKDVQLHLECQWNMWIPGFGSEEI*PYKKACT/PEAHKQRMALIRKTTKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide