RetrogeneDB ID:
retro_mputfur_460
Organism:
Location:
GL896911.1:3686463-3686760 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
51.52 %
Coverage:
68.28 %
Frameshifts:
0
Stop codons:
4


Parental gene:
Parental gene symbol:
UBE2V2
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2 variant 2 [Source:HGNC Symbol;Acc:12495]

Genomic region (view in browser)





>retro_mputfur_460
AAGAATGTTAAAGGGAATAATCTGGTGACCCACGTTGAAGCTGATGAATAAAGGATACTT
TCAAGGTGAGCAGGCGTGAGTGTTAGGTCACCAAGGGCAAAGTATGAAAACAAAATATAC
AGACTGAAATTAGAATGTGGATCTAAATATCCAGAAGCTTCTCCATTGCTTTGATTTGCA
ACAAAAATTTATATGAATGAGATAAATACTCCCAGTGAAATAATGGATGTCCTGAGCATA
GTCGTGTTAGCAAAATGGCAAAACTCCTAAAACTTTAAAGTTGTACTTCCAGAGGTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQEL
K.V.........E.DE...L.R..G.....PR..YEN.IY.LK.ECG.KYPEA.P...F.TKI.MN.IN..S...D..SI.VLAKWQNS...KVVL.E.
Retrocopy
KNVKGNNLVTHVEADE*RILSR*AGVSVRSPRAKYENKIYRLKLECGSKYPEASPLL*FATKIYMNEINTPSEIMDVLSIVVLAKWQNS*NFKVVLPEV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide