RetrogeneDB ID:
retro_mputfur_465
Organism:
Location:
GL896911.1:12466006-12466335 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.65 %
Coverage:
53.05 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
FBXO27
Parental gene aliases:
No gene alias available
Parental gene description:
F-box protein 27 [Source:HGNC Symbol;Acc:18753]

Genomic region (view in browser)





>retro_mputfur_465
GGACCATAGCTGCCTGTACCCCACCCCTCCACACCCCCACTGGGGTGGGGCCCTGCCTCC
TGGGCCACTTCTGTGAGCAAGCGCAGATGGATCGATGCAACCTCACTTGTAATGCCTGCA
GCCAAGAAAGCCTCTGGAAACGGATCGTGTAGCATGGTGGGGATGGCTGGGTGGTGGAGG
TGAACAAGTCAACAGTACCCGGAGCTCCCTGCTTTGTGTCTTTCTTCAGCAGATGTGGTG
AGAAACAGCTCTTAGACTTGGAGGAGCAGGGTGTATGGCCAGAACTGGTAGATGGTAACA
ACTGAGATTTGTCAACCAGAGGGTCCTGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GSLLPLARSCLP-PTRDGRPCLLGRFCERRPIGR-NLIRNPCGQEGLRKWMVQHGGDGWVVEVNRSTVPGAPSQTCFVSSFSWCRKKQVLDLEEEGLWPE
G..LP......P.PT..G.PCLLG.FCE.....R.NL..N.C.QE.L.K..V.HGGDGWVVEVN.STVPGAP...CFVS.FS.C..KQ.LDLEE.G.WPE
Retrocopy
GP*LPVPHPSTP/PTGVG-PCLLGHFCEQAQMDRCNLTCNACSQESLWKRIV*HGGDGWVVEVNKSTVPGAP---CFVSFFSRCGEKQLLDLEEQGVWPE


Parental protein
LLDSGKIEICVSDWW
L.D...........W
Retrocopy
LVDGNN*DLSTRGSW


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide