RetrogeneDB ID:
retro_mputfur_466
Organism:
Location:
GL896911.1:20199875-20200203 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.29 %
Coverage:
70.51 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
NDUFAB1
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa [Source:HGNC Symbol;Acc:7694]

Genomic region (view in browser)





>retro_mputfur_466
ATGGGGATTCCCCAGCCCGCCTCACTTCTTGCACACTTCCCAGTTACACACTTGTGCCGC
CGGTTTAGTGATGCACCCTCTTTGATGTTAGAGGGAAGCACGGACCGTGTTCTTTACAGC
TCGAAGCTCTGTGACAAGGTTGACCCAGAGAAGCTCTCAGTAAATTCCCACTTTGCAAAA
GACCAGGGCTTAGGCAGTTTGGACCAAATGGAGATTATCATGGCCGTGGAGGAAGAATTT
GGTTTGAAGTCGCTGATACAGATGGGGAGGAGTTAATGCATCCCCGAAAACTGTAGGTTA
CATTGCAGAGAAGAAGGGTGTGTATGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGGPSPALRGGEVPLTQLGRQYSDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFG-FEIPDTDAEKLMCPQEI-
MG.P.PA......P.T.L.R..SDAP.L.LEG..DRVLY..KL.DK.DPEKLSVNSHF.KD.GL.SLDQ.EIIMA.E.EFG.FE..DTD.E.LM.P....
Retrocopy
MGIPQPASLLAHFPVTHLCRRFSDAPSLMLEGSTDRVLYSSKLCDKVDPEKLSVNSHFAKDQGLGSLDQMEIIMAVEEEFG/FEVADTDGEELMHPRKL/


Parental protein
VDYIADKKDVYE
V.YIA.KK.VYE
Retrocopy
VGYIAEKKGVYE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide