RetrogeneDB ID:
retro_mputfur_468
Organism:
Location:
GL896911.1:2732632-2732982 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
51.24 %
Coverage:
73.75 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
SCOC
Parental gene aliases:
No gene alias available
Parental gene description:
short coiled-coil protein [Source:HGNC Symbol;Acc:20335]

Genomic region (view in browser)





>retro_mputfur_468
GGGCCTGAGGTGTCCTCCTGGTCCATCTCTCTCCCAGCACCTCCAAAGGGGGATCATTCA
TCAAGGATTTTATATCCAAGGCCCAAAATGTGTTGCCCAAGACGATGAATGCCAACATGG
ATACAGCTGATGCTGAAAATCAACTGGAACTGGAGGACAAAGCACGACTTTAATTAGTCA
ATTGCTGAAACATCAGCACACACTTAAAGATCTCTCTGAAGAGCAGGTGCAGTTAAGGAA
GAAAATCGGAAGCTAAAATCAGAAAACCAAATTCTTAGATAGTATATATAGAACACCTCG
TGTCAGCTTCCAGTGGTTTTCAAACAACTTACACAAAAAGCAAGAGAAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GPEASIAFVLLPPPQFSVADHSSRILYPRP-ENLLPKMMNADMDAVDAENQVELEEKTR--LINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQY
GPE.S.....LP.P.....DHSSRILYPRP..N.LPK.MNA.MD..DAENQ.ELE.K.R..L.N......H....L..R.........K....N.....Y
Retrocopy
GPEVSSWSISLPAPP--KGDHSSRILYPRP/QNVLPKTMNANMDTADAENQLELEDKARL*LVNC*NISTHLKISLKSRCS*GRKSEAKIRKPNS*I-VY


Parental protein
IENLMSASSVFQTTDTKSKRK
IE.L.SASS.FQTT.TKSKRK
Retrocopy
IEHLVSASSGFQTTYTKSKRK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide