RetrogeneDB ID:
retro_mputfur_469
Organism:
Location:
GL896911.1:3769572-3769887 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.05 %
Coverage:
89.83 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
TCEB2
Parental gene aliases:
No gene alias available
Parental gene description:
transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) [Source:HGNC Symbol;Acc:11619]

Genomic region (view in browser)





>retro_mputfur_469
CACAAGACCACCATCATCACAGAGGCCAAGGAGTGGAGCACAGTGCTGGAGCCGAAGCAC
GTCGTCGAGGGTATGCTTAAGTGTGCCAGGACACGCAGACACTCTACAAGGATCACCAGC
TTCTGGATGGCGGCACGGCCCTGGAACAGTGTGGTTTCACCAGTGAGACTGGGTGGCCGC
AGGACCCAGCTACTGTAAAGCTGCCCTTCCAGGGGATTGAACTTGACAGGCCTTGTGCCT
GGAGCCCTACCCTAATTGACCTGTGCTGCCCGTGCAATGACACCATAGGACTGAGGGAGC
AGAGTGGAGGAACAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HKTTIFTDAKESSTVFELKRIVEGILKRP-PDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR-ADEAFEALRIEPFSSPPELP-DVMKPQ
HKTTI.T.AKE.STV.E.K..VEG.LK....D.Q.LYKD.QLLD.G..L..CGFTS.T..PQ.PATV.L.F...D....AL..EP....P.LP...M.P.
Retrocopy
HKTTIITEAKEWSTVLEPKHVVEGMLKCA/QDTQTLYKDHQLLDGGTALEQCGFTSETGWPQDPATVKLPFQ/GD*T*QALCLEPYPN*PVLP/RAMTP*


Parental protein
DSGSSANEQ
D.GS...EQ
Retrocopy
D*GSRVEEQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide