RetrogeneDB ID:
retro_mputfur_473
Organism:
Location:
GL896911.1:13920267-13921779 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.95 %
Coverage:
63.09 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PCDHA3
Parental gene aliases:
No gene alias available
Parental gene description:
protocadherin alpha 3 [Source:HGNC Symbol;Acc:8669]

Genomic region (view in browser)





>retro_mputfur_473
GAGAGGTACCAAATTTGTAGTGGTTTTGCGATGCTGTTTCCCAGGCAAGAAGGCAAGGGA
ACCCTGCATTTGCTGCTCTGCGTTCTGCTCCTCGCAGCCTGGAAGACTGGGAGTGGTCAG
GTCCACTATTCGGTCCCGGAGGAGGCCAAACACGGCACCTTCGTGGGCCGCATAGCCCAG
GATTTGGGGCTGGAGCTGGCAGAGCTGGTGCCACGCCTGTTCCGGGTGGCGTCCAAAGGC
CACGGGGACTTTCTGGAGGTAAATCTGCAGAATGGCATTTTGTTTGTGAATTCTCGGATC
GACCGGGAAGAGCTGTGCGGGCAGAATCTGGAGTGCAGCATCCACCTGGAGGTGATCGTG
GATAAGCCGCTGCAGGTTTTCCATGTGGAGGTGGAGGTGAAGGACATTAATGATAACCCA
CCGGTTTTCAGAGCAAGAGAACAAAGGTTTTTTATTCCTGAATCTAGACTGGTGGATTCA
CGTTTCCCGATAGAGGGCGCTGCTGATGAAGACATTGGTACCAACGCTCTTCTAACATAC
ACCCTCAGCCCCAGTGATTATTTCTCTTTGGATGTACAGGCAAGTGATGAACTCAGTAAG
TCACTTTCACTTGAATTGAGGAAGTCTTTGGATAGAGAAGAAACACCAGAACTTCATTTA
TTATTGACAGCCACTGATGGGGGCAAGCCAGAGCTTGAAGGTACAGTTCAGCTGCTGATC
ACAGTGCTGGATGTTAATGATAATGCCCCATTGTTTGCCCAGGCTGGGTACAGAGTCCAT
TTATTAGAGAGTACAGCAAATGGAACATTAGTGACTACATTAAATGCCTCTGATGCCGAT
GAAGGTGTAAATGGCGAAATTGTTTTTTCCTTTGGCAGTGATGTTCCTCTAAACATTCAA
AAAAACTTCAAAATTGATTCCAGCTCAGGAGAAATTAGACTAATTGGTAGACTGGATTAT
GAAGAAACGAAATCCTATGAAATTCAGGTAAAAGCAGTTGATAAAGGAAATCCTCCAATG
TCGAATCACTGCAAAGTTTTAGTGAAAGTGCTGGATGTAAATGACAATGCTCCACAACTG
GCAATCACACCTCTGTCTTTGCCGGTCAGAGAGGACTCTCCACTAGGCACCGTCATCGCC
TTTGTCTCCGTGTCCGACCGTGACTCTGGTGTCTATGGGCAGGTGACCTGCTCTGTGATG
CCTCCTATCCCATTCAAGCTGGTGTCCACCTTCAAAAACTACTATTCGCTGGTGCTGGAC
AGCGCCTTGGACCGCGAGAGCGTGTCCAACTATGAGCTGGTGGTGACCGCAAGGGACGGG
GGATCGCCTTCGCTCTCCGCCACGGCCAGCATGTCCGTGGAAATGGCGGACGTGAACGAC
AACGCGCCGGCGTTCGCGCAGCCCGAGTACACGGTGTTCGTGAAGGAGAACAACCCGCCC
GGCTGCCACATCTTCACGGTGTCGGCGCGGGACGCGGACGCGCAGGAGAACGCGCGGGTG
TCCTACTCGCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ERRNIWERLATVFSWREEGSGARQLLLSLLLLTIWETGSGQVHYSVLEEAKHGTFVGRIAQDLGLELAELVPRLFRVASKGHGDLLEVNLQNGILFVNSR
ER..I....A..F..R.EG.G...LLL..LLL..W.TGSGQVHYSV.EEAKHGTFVGRIAQDLGLELAELVPRLFRVASKGHGD.LEVNLQNGILFVNSR
Retrocopy
ERYQICSGFAMLFP-RQEGKGTLHLLLCVLLLAAWKTGSGQVHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRVASKGHGDFLEVNLQNGILFVNSR


Parental protein
IDREELCGRSLECSIHLEVIVDRPLQVFHVEVEVKDINDNQPVFPTAVKKLFIYESRLPGSRIPLEGASDADIGANSLLTYSLNSNDYFTLDIKRNDANI
IDREELCG..LECSIHLEVIVD.PLQVFHVEVEVKDINDN.PVF.......FI.ESRL..SR.P.EGA.D.DIG.N.LLTY.L...DYF.LD....D...
Retrocopy
IDREELCGQNLECSIHLEVIVDKPLQVFHVEVEVKDINDNPPVFRAREQRFFIPESRLVDSRFPIEGAADEDIGTNALLTYTLSPSDYFSLDVQASDELS


Parental protein
KSLGLVLKKVLNREDTPEHHLLITAVDGGKPELTGTTQVKITILDVNDNAPEFERSVYKVSLFENAPNGTLAVIVNASDLDEGVNKDIVYSFNTDMSADT
KSL.L.L.K.L.RE.TPE.HLL.TA.DGGKPEL.GT.Q..IT.LDVNDNAP.F....Y.V.L.E...NGTL....NASD.DEGVN..IV.SF..D.....
Retrocopy
KSLSLELRKSLDREETPELHLLLTATDGGKPELEGTVQLLITVLDVNDNAPLFAQAGYRVHLLESTANGTLVTTLNASDADEGVNGEIVFSFGSDVPLNI


Parental protein
LSKFHLDPVSGYISVKGNIDFEDTKLYEIQVDATDKGNPPMAGHCTVLVEILDVNDNVPELVIKSLSLPVLEDTPLGTVLALISVSDRDSGANGQLTCTL
...F..D..SG.I...G..D.E.TK.YEIQV.A.DKGNPPM..HC.VLV..LDVNDN.P.L.I..LSLPV.ED.PLGTV.A..SVSDRDSG..GQ.TC..
Retrocopy
QKNFKIDSSSGEIRLIGRLDYEETKSYEIQVKAVDKGNPPMSNHCKVLVKVLDVNDNAPQLAITPLSLPVREDSPLGTVIAFVSVSDRDSGVYGQVTCSV


Parental protein
SPHVPFKLVSTFKNYYSLVLDSALDRESVSNYELVVTARDGGSPSLSATASMSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFKTKGASDADIRANA
.P..PFKLVSTFKNYYSLVLDSALDRESVSNYELVVTARDGGSPSLSATASMSVE.ADVNDNAPAFAQPEYTVFVKENNPPGCHIF.T..A.DAD...NA
Retrocopy
MPPIPFKLVSTFKNYYSLVLDSALDRESVSNYELVVTARDGGSPSLSATASMSVEMADVNDNAPAFAQPEYTVFVKENNPPGCHIF-TVSARDADAQENA


Parental protein
MLTYTL
...Y.L
Retrocopy
RVSYSL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide