RetrogeneDB ID:
retro_mputfur_475
Organism:
Location:
GL896911.1:21124786-21125011 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.73 %
Coverage:
61.48 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
Gm2178
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348]

Genomic region (view in browser)





>retro_mputfur_475
GCATTCAGAATGGTCCAGCGTTTGACAGGCCACTGTAGGTTGTCCTACAATACAGTCTCT
ACCAAAACTGGGCTGTCCCAAACCTCTGGTAATAAAATTGTTTACCTTTAGACCTAGAAA
GTTGGGAAAGCACCAAATCTGCATGTGATGTGGGCCCAGACTGACTTCGAAGAGTTCAAG
CAGAGAGACCTTAAAGTCCTTATGAGATTGTATAAAACGAAAAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AFRMVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAP-KSACGVCPGRLRGVRAVRP-KVLMRLSKTKK
AFRMVQRLT...RLSYNT.S.KT.LS.T.GN.IVYL.T.KVGKAP.KSAC.V.P..LR.V.A.RP.KVLMRL.KTKK
Retrocopy
AFRMVQRLTGHCRLSYNTVSTKTGLSQTSGNKIVYL*T*KVGKAP/KSACDVGPD*LRRVQAERP\KVLMRLYKTKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide