RetrogeneDB ID:
retro_mputfur_478
Organism:
Location:
GL896912.1:7646735-7647544 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.12 %
Coverage:
77.21 %
Frameshifts:
6
Stop codons:
4


Parental gene:
Parental gene symbol:
MDH2
Parental gene aliases:
No gene alias available
Parental gene description:
malate dehydrogenase 2, NAD (mitochondrial) [Source:HGNC Symbol;Acc:6971]

Genomic region (view in browser)





>retro_mputfur_478
CATACACCCTGAGTTGCTGCTGATCTGAGCTGCACGGAGATTGGAGCAACCGGGAAGGGC
TGCCTCACACCCGAGTAGCTGCCAGACTGCTCGAAAGGTTGCCATGGGGTGGTTATTCCA
GCAGGAGCCCCGAGGAAACCATGCATGACAGGGGTGACCTGTCCAACACTAGTGCCCCAA
TTGTGGCCACCCTGGCTACCTTCTGCCCCTGGCATTGCCCTGAGGCATGAGCGGCATCCT
TTCAAATCTGGTTAACTCCATCATCCCAATGGCAACAGAAACTTTCAAGAAACACGGAGC
ACACACCTTAATAAAATCTTTGGAGTGACAACCTTGGACATTGCCAGAGCCAAGACTTTT
ATTATAGAACTGAGGGGTTTGGCTCCTGCTTGCATCAATGTTCCTGTTACTGGTGGCCAT
GCTGGGAAGACTGTCATCCTCCGATCTCCCCAAGAACTCTCAAGGTGGACGTTCCTCCAG
AACCAGCTGACAGCTGTTACTGGGAAGATTCAGGAAGCCCACATAGAAGAGGTGAAGGTC
TAAGCCAGAGCAGGCTCTGCTGCCCTGTCCATGGCTATGTGGGAGCCGAGTTTGTCTTCT
CCCTTGTGGAGGCAATGAACAGGAAGGAAGGAGTTGTTCAGTGTTTCTTCATTAAGTCCC
AAGAAACAGACGGGGCTTATTTCTCTACACCATTATTCCTGGGGGCAAAGGGCATCTAGA
AGAATCCAGGCATCGATAAGATCTCCCCTTCCAAAGAGAAGATGATAGCAGAAGCCATCC
CTGAGCTGAAGGCCTCCATCAAGAACGGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HTPGVAADLSHIETRATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMT-RDDLFNTNASIVATLTAACAQHCPEA-MICIISNPVNSTIPIATEVFKK
HTP.VAADLS..E..AT.KG.L.PE.LPDC.KGC..VVIPAG.PRKP.MT.R.DL.NT.A.IVATL...C..HCPEA.M..I.SN.VNS.IP.ATE.FKK
Retrocopy
HTP*VAADLSCTEIGATGKGCLTPE*LPDCSKGCHGVVIPAGAPRKPCMT/RGDLSNTSAPIVATLATFCPWHCPEA/MSGILSNLVNSIIPMATETFKK


Parental protein
HGAY-NPNKIFGVTTLDIVRANTFIAELKGLDPARVNVPVIGGHAGKTII-PLISQCTPKVDLP-QDQLTAVTGRIQEAGTEVVKAKAGAGSATLSMA-Y
HGA....NKIFGVTTLDI.RA.TFI.EL.GL.PA..NVPV.GGHAGKT.I.P.IS..T.KVD.P.Q.QLTAVTG.IQEA..E.VK..A.AGSA.LSMA.Y
Retrocopy
HGAH/HLNKIFGVTTLDIARAKTFIIELRGLAPACINVPVTGGHAGKTVI/PPISPRTLKVDVP\QNQLTAVTGKIQEAHIEEVKV*ARAGSAALSMA/Y


Parental protein
AGARFVFSLVDAMNGKEGVVECSFVKSQEADCGYFSTPLLLGKKGIEKNLGIGKISPFEEKMIAEAIPELKASIKKG
.GA.FVFSLV.AMN.KEGVV.C.F.KSQE.D..YFSTPL.LG.KGI.KN.GI.KISP..EKMIAEAIPELKASIK.G
Retrocopy
VGAEFVFSLVEAMNRKEGVVQCFFIKSQETDGAYFSTPLFLGAKGI*KNPGIDKISPSKEKMIAEAIPELKASIKNG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide