RetrogeneDB ID:
retro_mputfur_479
Organism:
Location:
GL896912.1:19232237-19232476 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
54.22 %
Coverage:
59.85 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
ATP5G1
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Source:HGNC Symbol;Acc:841]

Genomic region (view in browser)





>retro_mputfur_479
ATGTAGACCACCAAGGGACTACTCATTTACCTAGCACTGATCCACTGTTGTAGCTGTGGT
CTAATCAGGCCTATGTCTGCCTCTTTCTTCATAAGCCACAGATCCCACCTAAAGAGCCTT
CCTAGAGCACACCTCCATACTAGGTGGTCCAAAAGGAGTTCCAGACCAGTCTTTTCTCTC
AGGACAAAGACATAGAAGCCAAGCTAATTGCTGCTGCAGGCACCACAGTTGTGGCTGGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQTTGALLISPALIRCCTRDLIRPVSASL-LSRPDIPAKQPSYSSNSPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAG
M.TT..LLI..ALI.CC...LIRP.SAS..L..P.IP.K.PS.S...P..V...EFQTS..S.D.D..AK.I.A...TV.VAG
Retrocopy
M*TTKGLLIYLALIHCCSCGLIRPMSASF/LHKPQIPPKEPS*ST-PPY*VVQKEFQTSLFSQDKDIEAKLIAAAGTTV-VAG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide