RetrogeneDB ID:
retro_mputfur_484
Organism:
Location:
GL896913.1:5440127-5440904 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.38 %
Coverage:
86.62 %
Frameshifts:
4
Stop codons:
7


Parental gene:
Parental gene symbol:
SC5D
Parental gene aliases:
No gene alias available
Parental gene description:
sterol-C5-desaturase [Source:HGNC Symbol;Acc:10547]

Genomic region (view in browser)





>retro_mputfur_484
GATCTTGTGCTCAGTTTTGCAGATTTTTTTTTTTTTAACACCATACATTTATCTGGTTTC
ATGGTCTGAGGGTGACCTCTTCCGATAAACTATTAGTCTCCAAATTGTAACAAATCCTGG
TGTTTATATACTTTATTTCACTTTGCAACACTGAGCTATTATTTTATCTTTTACCATTCA
TTAGTGACACATCCATAACTTTTAAAGAATTAAGTCTATAGAGAGATTACATTTGCTGTC
CAATTATTGCCATAGATTAATATTCCTACTGTTTCATTACTTCTGCTAGAGTTGAGAGAT
TACAGCAAACTATATGATGACCTAGGAGAGTTTCCAAGTGGCTGGTTTCAGCTCATTATT
AGTATACTTTCTTTCCTCTTTTTCACTGATATCCTTATCTACTGGATTCACAGAGGCCTT
CATCATAGACTTGTGTAGAAACACATATATAAACCTCATCATCTCTGGAAGTTCCAAACT
CCATTTGCAAATCATGCTTTTCGTTCTTTGGAGGGCTTCCTTCAGAATCTACCCTGCCAT
ATATACCCTTTTATCTTTCCGTTACACAAGGTAGTATATTTAAGTTTGTACATCTTGATC
AATATCTGGACAATTACCATTCAGATGGCAATTTCCATGTTCCCCAAATCTGAAGGCCAT
TTATTAACGGCTCAGCCCATCATATAGACCACCAAATAATTCTTTGACTACAACTATGAA
TAGTATTTCACCTTGAGGGAGAGAATTAGAGGCTTGTTTAAAAATCCTTCCTCCTTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DLVLNAADYYFF-TPYIYPASWPEDNIFRQTISLLIVTNLGAYILYF-FFATLSYYFVYDHALMKHPQFLKNQVYREIIFTVQSLPWISIPTVSLFLLEL
DLVL..A......TPYIY..SW.E...FR.TISL.IVTN.G.YILYF..FATLSYYF...H.L..HP..LKN.VYREI.F.VQ.LP.I.IPTVSL.LLEL
Retrocopy
DLVLSFAXXXXX\TPYIYLVSWSEGDLFR*TISLQIVTNPGVYILYF/HFATLSYYFIFYHSLVTHP*LLKN*VYREITFAVQLLP*INIPTVSLLLLEL


Parental protein
RGYSKLYDDIGEFPSGWFRLIVSVLSFLFFTDMLIYWIHRGLHHRLVYKRIHKPHHLWKIPTPFASHAFHPVDGFLQSLPYHIYPFIFPLHKVVYLSLYI
R.YSKLYDD.GEFPSGWF.LI.S.LSFLFFTD.LIYWIHRGLHHRLV.K.I.KPHHLWK..TPFA.HAF....GFLQ.LP.HIYPFIFPLHKVVYLSLYI
Retrocopy
RDYSKLYDDLGEFPSGWFQLIISILSFLFFTDILIYWIHRGLHHRLV*KHIYKPHHLWKFQTPFANHAFRSLEGFLQNLPCHIYPFIFPLHKVVYLSLYI


Parental protein
LVNIWTISIH-DGDFRVPQILRPFINGSAHHTDHHM-FFDYNYGQYFTLWDRIGGSFKNPSSF
L.NIWTI.I..DG.F.VPQI.RPFINGSAHH.DH...FFDYNY..YFTL..RI.G.FKNPSSF
Retrocopy
LINIWTITIQ/DGNFHVPQI*RPFINGSAHHIDHQI\FFDYNYE*YFTLRERIRGLFKNPSSF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide