RetrogeneDB ID:
retro_mputfur_485
Organism:
Location:
GL896913.1:3707333-3707711 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
64.89 %
Coverage:
81.01 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
RPS11
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S11 [Source:HGNC Symbol;Acc:10384]

Genomic region (view in browser)





>retro_mputfur_485
ATGGTGGACATTGATACTGAAGGTGCCTACCTAAAGCAGCCAACTACCTTTCAAAATAAG
AAGAGGAACTTGCTTGGAGAATTGGCAAACAGAAGCTCTTACAATACCATAAAAACTTTG
GTATAGGATTAAGATCCTCAAGGAGGTCATTGATAGTCCTACACTGACAAGAAATGCCCT
TTCACTGGTAATGTCTCTATATGAGGGCAGATTCTGTCTACTGTGATCAAAATGAAGATA
CAGAAAACCACTGTCATCCACCGAGATGTCCTCTACCCCATATGAAAGTAAAACTGCTTG
GAGAAAGACCACTAGAATATGTCCGTACACCTGTCCCCCTGCTTCAGGGATGTCCAGATG
GGCAATACTGTCACAGTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MADIQTERAYQKQPTIFQNKKRVLLGET-GKEKLPRYYKNIGLGFKTP-KEAIEG-TYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIR
M.DI.TE.AY.KQPT.FQNKKR.LLGE..GK.KL..Y.KN.G.G.....KE.I....Y.DKKCPFTGNVSI.G.ILS.V..KMK.Q.T.VI.RD.L..I.
Retrocopy
MVDIDTEGAYLKQPTTFQNKKRNLLGEL/GKQKLLQYHKNFGIGLRSS/KEVIDS/SYTDKKCPFTGNVSI*GQILSTVI-KMKIQKTTVIHRDVLYPI*


Parental protein
KYNRFEKRHKNMSVHLSPCFRDVQIGDIVTV
K.N..EK.H.NMSVHLSPCFRDVQ.G..VTV
Retrocopy
K*NCLEKDH*NMSVHLSPCFRDVQMGNTVTV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide