RetrogeneDB ID:
retro_mputfur_490
Organism:
Location:
GL896914.1:17504691-17505086 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.68 %
Coverage:
99.25 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
LSM1
Parental gene aliases:
No gene alias available
Parental gene description:
LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:20472]

Genomic region (view in browser)





>retro_mputfur_490
ATGAACTCTGTGTCTGGCCCCACCAGCCTCCTCAAGGACATTGACAAGAAGCTCTTGGTC
CTGATTTAAGAAGGAAGGATGCTTATCAGTTTTATAAGAAGCGTTGATCAGTTTGCTAAT
TTAGTGTTACATCAGACTGTGGAGCCCATTCATGTGAGCAAAAAATACAGTGATATATCT
CAAGGGATTTTTGTGGTCAGAAGAGAAAATGTGGTCCTTCTAGGAGATATAGTCTCAGAA
AGGAGAGTGACATACCCCACCAGCAAGTGTCTGATGATGAGACCCTAGAAGAATGAAGGG
TAGAACAGTTGACCAAGCTAGAAGCTGAGAAGCTGGAATTTCAAGCTCTGGAGGATCGGG
GTCTCTCCATTCATCAAGCAGACACTGTTGATGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEI-DLEKESDTPLQQVSIEEILEEQ
MN...G..SL..DIDKK.LVL...GR.LI.F.RS.DQFANLVLHQTVE.IHV.KKY.DI..GIFVVR.ENVVLLG.I..L.KESD.P.QQVS..E.LEE.
Retrocopy
MNSVSGPTSLLKDIDKKLLVLI*EGRMLISFIRSVDQFANLVLHQTVEPIHVSKKYSDISQGIFVVRRENVVLLGDI/SLRKESDIPHQQVSDDETLEE*


Parental protein
RVEQQTKQEAEKLKVQALKDRGLSIPRADTLDE
RVEQ.TK.EAEKL..QAL.DRGLSI..ADT.DE
Retrocopy
RVEQLTKLEAEKLEFQALEDRGLSIHQADTVDE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide