RetrogeneDB ID:
retro_mputfur_491
Organism:
Location:
GL896914.1:19423886-19424232 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.62 %
Coverage:
72.78 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
RPS11
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S11 [Source:HGNC Symbol;Acc:10384]

Genomic region (view in browser)





>retro_mputfur_491
ATGGCGGACATTCAGGCTGAGCATGTGTACCAGAAACAGCTGACCAGCTTCCAACATAAG
AAGAGGGGCCTGTTTGGAGAAACTGGCAAAGAGAAGGTCCTGCGATACTAAAGAAACATC
AGTCTGGGCATTGAGATGCCGATGGAGGCCACGGAGGACACCTGTACTGACAAGTAATGG
CCCTTTACTGATCGTGTCTCCATCTGAAGACAGATCCCGTCTGGGGGGGGTGACCAAGAT
GAAGACACAAAGGCCCATTTTCACCCCCTGAGACTACCTCCACCACAACCTAAAGTACAG
CTACTTCGAGAAATGCCACAAGAACATATCCATGCACCTGTGCCCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MADIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIRGRILS-GVVTKMKMQRTIVIRRDYLHYIRKY
MADIQ.E..YQKQ.T.FQ.KKR.L.GETGKEK..RY..NI.LG...P.EA.E.T..DK..PFT..VSI...I.S....TKMK.QR.I....DYLH...KY
Retrocopy
MADIQAEHVYQKQLTSFQHKKRGLFGETGKEKVLRY*RNISLGIEMPMEATEDTCTDK*WPFTDRVSI*RQIPS\XXXTKMKTQRPIFTP*DYLHHNLKY


Parental protein
NRFEKRHKNMSVHLSP
..FEK.HKN.S.HL.P
Retrocopy
SYFEKCHKNISMHLCP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide