RetrogeneDB ID:
retro_mputfur_492
Organism:
Location:
GL896914.1:12232257-12233227 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.18 %
Coverage:
97.31 %
Frameshifts:
7
Stop codons:
5


Parental gene:
Parental gene symbol:
Ldhb
Parental gene aliases:
No gene alias available
Parental gene description:
lactate dehydrogenase B [Source:MGI Symbol;Acc:MGI:96763]

Genomic region (view in browser)





>retro_mputfur_492
GCACCAGTTGCAAGAAGAAGAAGCAACCATCCCAACAACAAGATCACTGTAGTGCGTGTT
ACACAAGTCGGCATGACCTGTGCCATCAACATTGTGGGAAAGCCTCTGGCAGATGAACTT
GTGTGGATGGATGTTTTGGAAGATAAACTCAGAGGAGAAATGATGGATCTGCAGCATGGG
AGCTTATTTCTTCAGACACCTAAAATTGCAGCAGATAAGGATTACTCTGTAATGCCAATT
CTAATATTGTGATAGTAAACCGCAAGAGTCGGCCCCCAGGAGGGGGAAAGCCCTCTCAAT
CTGTTGCAAGGAATGTTAGTATCTTCAAATGCAATATTCCTCAGATAGTCAAGTACAGTC
CTGATTATATCAAAATTGTGGTTTCCAAACCAGTGGATATTCTCACATATGTTACCTGGA
AACTAAATGGATTACCCAAGCACCATGTGATGGGAAGTGAGTGTAATCTAGATGCTGCTA
GATTTTGCTACTTTATGGCTGAAACTTAGCATTCATCCCAGCAGCTGCCATGGATGGGTT
TTGGGAGAATATGGCAACTCAAATGTGGCTTTGTGGAGTGGAGTGAATGTGTCAGCTGTT
TGTCTCCAGGAACTGAATCCAGAAATGGGAACAGACAATGACCATGAAAATTGGAGGGGA
AAGCATAAGAGGTGGTCGAAAGTGCCTATGAAGTCATCAAGCTAAAAGGATATATCAGCT
GGACTATTGGATTAAGTGTGGTTGTTCTCATCTAATCCATGTTGAAAGTCTATCCAACAC
TCATCCAGAGTGAATGATGGTATAGGGAACATATGGCATGGAGAAGTAAGTCTTCCTGAG
CTTTCCATGTACCCTGGACTCGTGGGGATTAATCATTGTGATCAGCCAGAAGCTGAATGA
TGATGAGGGTGCTCAGCTCAAGAAAAATGCACAGACTTTTTAGGAAATTCAGAAAGATCT
GAAAGAGCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
APVAEEDAAVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSV-TANSKIVVV-TAGVRQQEGESR
APVA......PNNKITVV.V.QVGM.CAI.I.GK.LADEL...DVLEDKL.GEMMDLQHGSLFLQTPKI.ADKDYSV..ANS.IV.V.TA.V..QEGES.
Retrocopy
APVARRRSNHPNNKITVVRVTQVGMTCAINIVGKPLADELVWMDVLEDKLRGEMMDLQHGSLFLQTPKIAADKDYSV/NANSNIVIV\TARVGPQEGESP


Parental protein
LNLVQ-RNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAE-KLGIHPSS-CHGWILGEHGDSSVAVWSG
LNL.Q.RNV..FK..IPQIVKYSPD.I.IVVS.PVDILTYVTWKL.GLPKH.V.GS.CNLD.ARF.Y.MAE..L...P...CHGW.LGE.G.S.VA.WSG
Retrocopy
LNLLQ/RNVSIFKCNIPQIVKYSPDYIKIVVSKPVDILTYVTWKLNGLPKHHVMGSECNLDAARFCYFMAE/NLAFIPAA/CHGWVLGEYGNSNVALWSG


Parental protein
VNVAGVSLQELNPDMGTDNDSENWKEVHKM-VVESAYEVIKLKGYTNWAIGLSVADLIESMLK-NLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLT
VNV..V.LQELNP.MGTDND.ENW...HK..VVESAYEVIKLKGY..W.IGLSV..LI.SMLK..LS..HP...MV.G.YG.E..VFLS.PC.L...GL.
Retrocopy
VNVSAVCLQELNPEMGTDNDHENWRGKHKR/VVESAYEVIKLKGYISWTIGLSVVVLI*SMLK/SLSNTHPE*MMV*GTYGMEK*VFLSFPCTLDSWGLI


Parental protein
SVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
.VI.QKL.DDE.AQLKK.A.T...IQKDLK.L
Retrocopy
IVISQKLNDDEGAQLKKNAQTF*EIQKDLKEL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide