RetrogeneDB ID:
retro_mputfur_495
Organism:
Location:
GL896915.1:10658765-10659262 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.29 %
Coverage:
67.06 %
Frameshifts:
6
Stop codons:
5


Parental gene:
Parental gene symbol:
MRPL47
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein L47 [Source:HGNC Symbol;Acc:16652]

Genomic region (view in browser)





>retro_mputfur_495
GAAGGTGGAGCTTCACGGACCTCTCAACAACTAGGAGTAAAAGTCATGAAGATACACATA
AACTCTGGCTGTCCTACTGAAAAAAGAAACATGCTCCTAACTCTTGAGCAGGGTGCCAAG
CATCAGAGATTGCCAATGTCAAGTCTGGAACAGTAAGAAAGGGCAGCAGATTGTACAGAT
GCATTAGATAAAGCTATCCAGGAAAGAGAAGATGCCCTAGGCTTCTTCAGACTGCTCAAG
AAAAAGCAAAGACCTCATGCTTGGGTAAGAGACACCTTTGGAAGGATTATCTAGCACAAG
TTCAAGAAGTCTATTCCTTAGTACCTAAGTAAGAGAGACAGTAAGAAATGATTCTTGGCC
ATGCTTTCCGTGGCGCATTCCGTCTGACTGAGACCGGAGAAGCAAGCCCACATGAAAGCC
AGTAGTAAGTCCAAGGGGAAAAAGAAAAATTTCTTCAGGAAGAGGTTCCACAACTTTCTG
AAGCCCAGAAGTCAAGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KSGASWTCQQL-RNKSNEDLHKLWY-VLLKE-RNMLLTLEQEAKRQKLPMPSPERLEKVVDSMDAIDKVVQEREDAL-RLLQTGQEKG-RPGAWRRDIFG
..GAS.T.QQL.R.KS.ED.HKLW..VLLK..RNMLLTLEQ.AK.Q.LPM.S.E..E...D..DA.DK..QEREDAL.RLLQT.QEK..RP.AW.RD.FG
Retrocopy
EGGASRTSQQL/RSKSHEDTHKLWL/VLLKK/RNMLLTLEQGAKHQRLPMSSLEQ*ERAADCTDALDKAIQEREDAL/RLLQTAQEKA\RPHAWVRDTFG


Parental protein
RIIWHKFKQWPIPWYLNKRYNRKRFFAMPYVERFVRLRLEKQARIEARKKSLEKKKEKFLQKKF-PHLSEAQKSS
RII.HKFK...IP.YL.KR...K.F.AM..V...V.LR.EKQA...A..KS..KKK..F..K.F.P.LSEAQKSS
Retrocopy
RII*HKFKK-SIP*YLSKRDSKK*FLAMLSVAHSV*LRPEKQAHMKASSKSKGKKK-NFFRKRF/PQLSEAQKSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide