RetrogeneDB ID:
retro_mputfur_498
Organism:
Location:
GL896915.1:19063644-19064069 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.93 %
Coverage:
75.13 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
HEBP1
Parental gene aliases:
No gene alias available
Parental gene description:
heme binding protein 1 [Source:HGNC Symbol;Acc:17176]

Genomic region (view in browser)





>retro_mputfur_498
AGTGACAAGCCTATGGGTGAGGATCTATGGGAAGCAACACCCAAAGTCATGAAGCATGTG
GGAGGCACTAATGACAAGGGAATCAGGATGGGAATGGCAGTTCCTATTTCCTTTAATGTG
TTTTCCAGTGAAGATGACTCCCTATGGAAGAAATTAAAAGTCTGGTTCCAGATTCCAAAC
CAGTTTCAGAGGAACCTGCCATTTCCTCACAATGACAGCATTAAGATGGAGGACAGGGAA
AGCATCACCGTCTCTTCCCTGCAGTTTGGTGGTTATGTCAAGGAAGCTGACTGTGTAGCT
CATGCCACCCAGCAGTGTATGGCCTCGGAAGGCACAGCCACTTAACAGAGTGACTTTTAC
CTCTGTTCTGGGTATGAACCTCTCATGAAGCCTATAGACATCACAATGAGGTCTAGCTCT
GCAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TDKPVDEGLREAMPKVMKYVGGTNDKGIGMGMTVPISFAVFPGDDGSLQKKLKVWFRIPNQFQSNPPVPTDDSIKIEERESITVYSLQFGGYAKEADYVA
.DKP..E.L.EA.PKVMK.VGGTNDKGI.MGM.VPISF.VF...D.SL.KKLKVWF.IPNQFQ.N.P.P..DSIK.E.RESITV.SLQFGGY.KEAD.VA
Retrocopy
SDKPMGEDLWEATPKVMKHVGGTNDKGIRMGMAVPISFNVFSSEDDSLWKKLKVWFQIPNQFQRNLPFPHNDSIKMEDRESITVSSLQFGGYVKEADCVA


Parental protein
HATQLRTALEGTATCRSDVYFCTGYDPPMKP-YGRRNEVWLVK
HATQ...A.EGTAT..SD.Y.C.GY.P.MKP.Y...NEV.L.K
Retrocopy
HATQQCMASEGTAT*QSDFYLCSGYEPLMKP/YRHHNEV*LCK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide