RetrogeneDB ID:
retro_mputfur_5
Organism:
Location:
GL897020.1:860431-861148 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
98.74 %
Coverage:
94.44 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Phosphatidylinositol glycan anchor biosynthesis, class L [Source:UniProtKB/TrEMBL;Acc:G9KGI3]

Genomic region (view in browser)





>retro_mputfur_5
GCAGGGGGCTTCCTCTGGGTTTGGGACTCCTGGGAAAGAATGAGAAGTCAGGAGCCGGCT
GGCGTCCCGGGAGATGGAAGTAAGACCCTCCTGGTGATCGCGCACCCCGATGATGAAGCC
ATGTTCTTTGCTCCCACTTTGCTAGGCTTGGCCCGCCTGAGGCACCGGCTGTCTTTGCTC
TGCTTCTCTGCAGGAAATTACTACAATCAAGGGGAGATGCGTAAGAAAGAACTTTTGCAG
AGCTGTGATGTTTTGGGGATTCCACGTTCCAGTATAATGATTATTGACAACAGGGACTTC
CCAGATGACCCAGGTGTGCAGTGGGACACAGAGCGTGTGGCTGGCACCCTCCTCCAGCAC
GTGGAAGCAAATGGCATCAACCTGGTGGTGACGTTCGATGCAGGGGGAGTCAGTGGTCAC
CGAAATCATGTTGCTCTGTATGCAGCTGTGAGGACCCTCCACTCAGAAGGGAAGTTACCT
AAAGGGTGCTCGGTGCTCACACTTCAGTCAGTGAATGTGTTGTGCAAGTACATCTCCCTT
CTGGACCTGCCCTTTTCTCTGCTTCATACCCGGGATGTCCTCTTCGTGCTCACCAGCAAA
GAAGTGGCACAGGCCAAGAGAGCCATGTCCTGCCACCGCAGCCAGCTGCTCTGGTTCCAC
CGCCTCTACTTACTCTTCTCCAGATACATGAGGATCAACTCCCTGCACTTCCTCTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AWGFLWVWDSWERMRSQEPAGVPGDGSKTLLVIAHPDDEAMFFAPTLLGLARLRHRLSLLCFSAGNYYNQGEMRKKELLQSCDVLGIPRSSIMIIDNRDF
A.GFLWVWDSWERMRSQEPAGVPGDGSKTLLVIAHPDDEAMFFAPTLLGLARLRHRLSLLCFSAGNYYNQGEMRKKELLQSCDVLGIPRSSIMIIDNRDF
Retrocopy
AGGFLWVWDSWERMRSQEPAGVPGDGSKTLLVIAHPDDEAMFFAPTLLGLARLRHRLSLLCFSAGNYYNQGEMRKKELLQSCDVLGIPRSSIMIIDNRDF


Parental protein
PDDPGVQWDTERVAGTLLQHVEANGINLVVTFDAGGVSGHRNHVALYAAVRTLHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPFSLLHTRDVLFVLTSK
PDDPGVQWDTERVAGTLLQHVEANGINLVVTFDAGGVSGHRNHVALYAAVRTLHSEGKLPKGCSVLTLQSVNVL.KYISLLDLPFSLLHTRDVLFVLTSK
Retrocopy
PDDPGVQWDTERVAGTLLQHVEANGINLVVTFDAGGVSGHRNHVALYAAVRTLHSEGKLPKGCSVLTLQSVNVLCKYISLLDLPFSLLHTRDVLFVLTSK


Parental protein
EVAQAKRAMSCHRSQLLWFRRLYLLFSRYMRINSLHFL
EVAQAKRAMSCHRSQLLWF.RLYLLFSRYMRINSLHFL
Retrocopy
EVAQAKRAMSCHRSQLLWFHRLYLLFSRYMRINSLHFL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide