RetrogeneDB ID:
retro_mputfur_501
Organism:
Location:
GL896916.1:11637236-11637694 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.64 %
Coverage:
98.71 %
Frameshifts:
4
Stop codons:
1


Parental gene:
Parental gene symbol:
FXN
Parental gene aliases:
No gene alias available
Parental gene description:
frataxin [Source:HGNC Symbol;Acc:3951]

Genomic region (view in browser)





>retro_mputfur_501
TTGAGCCTTCATGGCCTCCATTACATTGTGAATGTCAAAAAGCAGGTGTTTGTTTGATGA
CTGTGTGGACAGCGGGAACTTCGGGGGATCCTGCTCTCTGGATGAGACCACCCATAAAAG
GCTGGCAGAGAAGACTCTGGACTCCTTAGGAGAGTTTGTTGAAGACCTCGTGGAAAAACG
TTACATAATCAAAGACTGTGAGGTCTTGTCTGGGAGTGTTTTAACAGTTAAACTGGGTGG
AGATCCAGGAACCTATGGGATCAACAAGCAGACCCCAAACAAGCAAATCTGGTTATGTTC
ACTTTGGCGGGGTGGGGGGGCTACACTTAGGACTGGATGGGGAAGAACTTGGTGTACTCC
CACCACGATGTGTCCCTCCAGCATCTGTGGCCACTGGGCTGACTAAGGCCTTAAAAACCA
AATGGGACTGATCTTCTCTGGCCTCTTCTGGAAAAGGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LSLHRLDQMVNVKKQ-SVCWVTVRAVGTVGDPG-SLDETTYERLAEKTLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQI
LSLH.L...VNVKKQ..VC..TV...GT.GDP..SLDETT..RLAEKTLDSL.EF.EDL..K.Y...D..V..GS.VLTVKLGGD.GTY.INKQTPNKQI
Retrocopy
LSLHGLHYIVNVKKQ/GVCLMTVWTAGTSGDPA/SLDETTHKRLAEKTLDSLGEFVEDLVEKRYIIKDCEVLSGS-VLTVKLGGDPGTYGINKQTPNKQI


Parental protein
WLSSPSSGPKRYDWTG--RNW-VYAHDGVSLHEL-LAAELTEAFRTQLDLSSLAYSGKG
WL.S...G......TG..R.W.VY.H..VSL..L..A..LT.A..T..D.SSLA.SGKG
Retrocopy
WLCSLWRGGGATLRTGWGRTW/VYSHHDVSLQHL/VATGLTKALKTKWD*SSLASSGKG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide