RetrogeneDB ID:
retro_mputfur_504
Organism:
Location:
GL896916.1:11657015-11657808 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.65 %
Coverage:
100.0 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS3A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S3A [Source:HGNC Symbol;Acc:10421]

Genomic region (view in browser)





>retro_mputfur_504
ATGGCGGTCGGCAAGAACAAGTGCCTTAAGAAAGGCGGCGAAAAGGGAGGCAAGAAGAAA
GTGGTTGATCCATTTTCTAAGAAAGACTGGTATGATGTGAAAGCACCAGCTATGTTCAAT
ATAAGAAATATTGGAAAAACATTAGTCACAAGAACTCAAGGAGCCAAAATTGCATCTAAT
GGCCTCAAGGTTGTGTTTTTGACAGGAGCCTTGATGATCTGAAGAATGATAAAGCTGAGT
TTAGAAAATTCAAACGAATTATCGAGGTTGTTCAGGGCAAAGACTGCCTGACTAATTTCC
ATGGCATGGATCTTACCCATGGCAAAATGTGCTCCATGGCCAAAAAACAGCAGACCATGA
TTGAAGCTCATGTTTATGTCAAGACTACTGATGGTTATTTGCTTCATCTGTTTTCTGTTG
GTTTTACTAAAAAATGCAATAATCCAATTCAGAAGACCTCTTAAGCTCAGCACGAACAGG
TCCACCAAATTCAGAAAAAAGATGATGGAGATCATGACCCAAGAGGCACCGACAAATGAC
TTGAAGGAAGCGGTCAATAAATTGATTCCAGACAGCATCAGAAAAGGTATAGAAAAAGTT
TGTCAGCCCATTTATCCACTCCATGATAGTCTTTGTTAGAAAAGTAAAAATGCTGAAGAA
GCCCAAGTTTGAATTGGGAAAGCTCATGGGGCTTCGTGGTGGAGGTGGGAATTCTGGAAA
AGCTCCTGGGGATGAGACCGGTGCTAAAGTTGAGCGAGCTGATGGAGATGAGCCACCAGT
CCAAGAATCTGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLK-GRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTN
MAVGKNK.L.KGG.KG.KKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQG.KIAS.GLK.G.VF..SL.DL.ND...FRKFK.I.E.VQGK.CLTN
Retrocopy
MAVGKNKCLKKGGEKGGKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGAKIASNGLK/GCVFDRSLDDLKNDKAEFRKFKRIIEVVQGKDCLTN


Parental protein
FHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQI-RKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIE
FHGMDLT..KMCSM.KK.QTMIEAHV.VKTTDGYLL.LF.VGFTKK.NN.I.KTS.AQH.QV.QI.RKKMMEIMT.E..TNDLKE.VNKLIPDSI.K.IE
Retrocopy
FHGMDLTHGKMCSMAKKQQTMIEAHVYVKTTDGYLLHLFSVGFTKKCNNPIQKTS*AQHEQVHQI\RKKMMEIMTQEAPTNDLKEAVNKLIPDSIRKGIE


Parental protein
KACQSIYPLHD-VFVRKVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQESV
K.CQ.IYPLHD.VFVRKVKMLKKPKFELGKLM.L.G.G..SGKA.GDETGAKVERADG.EPPVQESV
Retrocopy
KVCQPIYPLHD\VFVRKVKMLKKPKFELGKLMGLRGGGGNSGKAPGDETGAKVERADGDEPPVQESV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide