RetrogeneDB ID:
retro_mputfur_505
Organism:
Location:
GL896916.1:14789116-14790085 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
85.02 %
Coverage:
83.85 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
NAP1L1
Parental gene aliases:
No gene alias available
Parental gene description:
nucleosome assembly protein 1-like 1 [Source:HGNC Symbol;Acc:7637]

Genomic region (view in browser)





>retro_mputfur_505
CTTGATGGTCTGGTAGAAACACCAACAGGATACATTGGAAGTTTGCCTAGGGTATCTAAA
AGACGAGTGAAAGCTCTCAAAAATCTTCAAATTAAATGTGCACAGGTAGAAGCCAAATTC
TAAGAGGAAGTTCATGATCTTGAAAGAAAGTATGCTGTTCTCTCTCAGCCTCTATTTGAT
AAGTGATCTGAGATCATTAATGCAATTTTGGAACCTACAGAAGAAGAACGCAAATGGAAA
CCAGATGAGGAGGATGAAATTTCGGAGGAGCTGAAAGAAAAAGCCAAGATTGAAGATGAG
AAAAAGGATGAAGAAAAAGAAGACCCCAAGGGAATTTCTGGATTCTGGTTAACTGTGTTT
AAGAACATTGACTTGCTCAGTGATATGGTTCAGGAACATGATGGACCTATACTGAAGCAG
TTGAAATATATTAAAGTGAAGTTCTCAGATGCTGGCCAGCCAATGAGTTTTGTTTTAGAA
TTTCACTTTGAACCTGGTGAATATTTCACAAATGAAGTGCTGACAACGACATATAGGATG
GGGTCAGAACCAGATGATTTTGATCCCTTTTCTTTTGGTGGACCAGAAATTAAGGGTTGT
ACAGGGTGTCAGAAAGATTGGAAAAAAGGAACGAATGTCACTGTGAAAACCATGAAGAAG
AAGCAGAAACACGAGGGATTTGGGACAGTTCGTAGTGTATCCAAAACAGTTTCCAATGAC
TTTTTCTTTAATTTTCTTGCCCCTCTTGAAGTTCCTGAGCGTGGAGATCTGGATGATAAT
GCTGAAGCTATCTTTGCTGCAGACTTTGAAATTGGTCACTTTTTACGTGAGTGTATAATC
CCAAGGTTAGTGTTTTACTTTACTGGAGAAGCTCCTGAAGATGATGATTATGATGAAGAA
GGTAAAGAAGCAGATGAGGAAGGGGAAGAAGATAAGGAAAACAATCCAGACTATGACTCA
AAGAAGGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDE
LDGLVETPTGYI.SLPRV.KRRV.ALKNLQ.KCAQ.EAKF.EEVHDLERKYAVL.QPLFDK..EIINAI.EPTEEE..WKPDEEDEISEELKEKAKIEDE
Retrocopy
LDGLVETPTGYIGSLPRVSKRRVKALKNLQIKCAQVEAKF*EEVHDLERKYAVLSQPLFDK*SEIINAILEPTEEERKWKPDEEDEISEELKEKAKIEDE


Parental protein
KKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGC
KKDEEKEDPKGI..FWLTVFKN.DLLSDMVQEHD.PILK.LK.IKVKFSDAGQPMSFVLEFHFEP.EYFTNEVLT.TYRM.SEPDD.DPFSF.GPEI.GC
Retrocopy
KKDEEKEDPKGISGFWLTVFKNIDLLSDMVQEHDGPILKQLKYIKVKFSDAGQPMSFVLEFHFEPGEYFTNEVLTTTYRMGSEPDDFDPFSFGGPEIKGC


Parental protein
TGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYD
TGCQ.DWKKG.NVT.KT.KKKQKH.G.GTVR.V.KTVSND.FFNF.AP.EVPE.GDLDD.AEAI.AADFEIGHFLRE.IIPR.V.YFTGEA.E..DDDYD
Retrocopy
TGCQKDWKKGTNVTVKTMKKKQKHEGFGTVRSVSKTVSNDFFFNFLAPLEVPERGDLDDNAEAIFAADFEIGHFLRECIIPRLVFYFTGEAPE--DDDYD


Parental protein
EEGEEADEEGEEEGDEENDPDYDSKKD
EEG.EADEEGEE..D.EN.PDYDSKKD
Retrocopy
EEGKEADEEGEE--DKENNPDYDSKKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide