RetrogeneDB ID:
retro_mputfur_506
Organism:
Location:
GL896916.1:18971854-18972771 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.79 %
Coverage:
87.97 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
ST13
Parental gene aliases:
No gene alias available
Parental gene description:
suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) [Source:HGNC Symbol;Acc:11343]

Genomic region (view in browser)





>retro_mputfur_506
CCGAGCGTTCTGTATACTGAGGAAATGCATTTCCTGCGGGAGTAGGTGGAGAGCATGGGG
GATAAAATACCACCTGCCACTCATAAAACTAAATTTGAAGACAGTATCAAGGAATAAAAA
CCAGATAGTAGAAGGCAGAGGAAAACATAAAGATAGATAAACCATCAAGTGAGGAAAGTG
ATCTAGAAACTGACCATGAAGGTGTGATTGAACCAGATACTGATGTCCCTCAAGAAATGG
GAGATGAAAATGTAGAGATAACCGAGGGAATGATAGATCAGGCAAATGATAAAAAAGTGG
CTGCCATTGATGCCCTAAATGATGGTGATCTAAAGAAAGCCATTGACTTGTTCACACATG
CCATCAAACTAAATCCTGGCTTAGCCATTCTGTATGCCAAGAGAGCCGGTGTCTTCATCA
AATTACAAAAGCCAAATGCTGCCATTCAAGACTGTGACAGAGCTATTGAAATAAATCCTG
ATTCAGCTCAGCCTTATAAGTGGCGAGGGAAAGCACATAGACTTCTGGGCCATTGGGAAG
AAGTAGCACATGATCTTGCCCTTGCTTGTAAACTGGATTATGATGAAGATGCTAGCGCAA
TGTTGAAAGAAATTCAACCGAGGGCCCAGAAAATTGATGAACATTGGAGAAAGTATGAGC
AAAAACATGAAGAGTGAGAGATCAAAGAAAAAATAGAAAGGGTTAAGAAGGCTCAGGAAG
AACATGAGAGAGCCCAGAGGGAGGAAGAAGCCAGACAATAATCAGGAGCTCAGTATAGTT
CTTTCCCAGGTGACTTTCCTGGGGGAATGCCTTGTAATTTTCCTGGAGGAATGCCTGGAA
TGGCAGGAATGCCTGGGCTCAATGAAATTCTTAGTGATCCGGAAGTTCTTGCAGTCATGC
AGGATCTGGAAGGTATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PSVLHTEEMRFLREWVESMGGKIPPATHKTKSEDSIKEEKPDSK-KAEENIKTDEPSSEESDLEIDNEGVIEPDTDAPQEMGDENAEITEEMMDQANDKK
PSVL.TEEM.FLRE.VESMG.KIPPATHKTK.EDSIKE.KPDS..KAEENIK.D.PSSEESDLE.D.EGVIEPDTD.PQEMGDEN.EITE.M.DQANDKK
Retrocopy
PSVLYTEEMHFLRE*VESMGDKIPPATHKTKFEDSIKE*KPDSR/KAEENIKIDKPSSEESDLETDHEGVIEPDTDVPQEMGDENVEITEGMIDQANDKK


Parental protein
VAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFIKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDAS
VAAIDALNDG.L.KAIDLFT.AIKLNP.LAILYAKRA.VFIKLQKPNAAI.DCDRAIEINPDSAQPYKWRGKAHRLLGHWEE.AHDLALACKLDYDEDAS
Retrocopy
VAAIDALNDGDLKKAIDLFTHAIKLNPGLAILYAKRAGVFIKLQKPNAAIQDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEVAHDLALACKLDYDEDAS


Parental protein
AMLKEVQPRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGSFPGGFPGGMPGNFPGGMPGMAGGMPGMAGMPGLNEILS
AMLKE.QPRAQKI.EH.RKYE.K.EE.EIKE.IERVKKA.EEHERAQREEEAR..SGAQY.SFPG.FPGGMP.NFPGGMPGMA.GMPG........E.L.
Retrocopy
AMLKEIQPRAQKIDEHWRKYEQKHEE*EIKEKIERVKKAQEEHERAQREEEARQ*SGAQYSSFPGDFPGGMPCNFPGGMPGMA-GMPGLNEILSDPEVLA


Parental protein
DPEVLAAM
....L..M
Retrocopy
VMQDLEGM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide