RetrogeneDB ID:
retro_mputfur_507
Organism:
Location:
GL896917.1:177888-178417 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.71 %
Coverage:
72.06 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
TPGS2
Parental gene aliases:
No gene alias available
Parental gene description:
tubulin polyglutamylase complex subunit 2 [Source:HGNC Symbol;Acc:24561]

Genomic region (view in browser)





>retro_mputfur_507
CTGGCTCAACTCAACCATGTCTTCTGTGTATTCACTCCCTAATGCACCAACTCTGGCAGA
CCTGGAGGATGATGCACTTAAAGCCAGTGAGAACCAGCCAGAGAAGCCTCACTTTGATTC
TCGCAGCATGGTATTTGAGCTGGATCCTTGCAATGGGAATGGGAAGGTTTGCCTTGTCTA
CAAAAGAGGGAAACCAATGCTAGCACAAGACACTGAGATCTGGTTCCTGGACAGAACATT
ATACTGGCATTTTCTCACAGACAACTTCACTGTTTACTATTGCCTGCTCATCACGCACCT
GGGCCTACCGCAGTGGCAGTACACCTTCACCAGCCATGGCATTAGCCCACAGGCCAAGTA
GTGGTTCAGCATGTATAAACCCATCACCTACAACACAGACCTACTTGCAGAAGAGACCAA
CTCCTTCGTGAACAAGCTGGATCCCAGTGAAGTGTTCAAGAGCAAGAACAAGACCTTAAT
CCCCAAAAGGCCAGTACCGCCTGCACGTGGCCAGAAAGGACCCCCAGGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LTQLNQ-SSVYSLPNAPTLADLEDDALEASENQPEKPHFDSRSVIFELDPCNGNGKVCLVYKRGKPALAQDTEIWFLDRALYWHFLTDTFTAYYRLLITH
L.QLN..SSVYSLPNAPTLADLEDDAL.ASENQPEKPHFDSRS..FELDPCNGNGKVCLVYKRGKP.LAQDTEIWFLDR.LYWHFLTD.FT.YY.LLITH
Retrocopy
LAQLNH\SSVYSLPNAPTLADLEDDALKASENQPEKPHFDSRSMVFELDPCNGNGKVCLVYKRGKPMLAQDTEIWFLDRTLYWHFLTDNFTVYYCLLITH


Parental protein
LGLPQWQYAFTSYGISPQAKQWFNMYKPVTYNTDLLAEETNSFVNKLDPSKVFKSKNKTLIPKKKGPVQPAGGQKGPPG
LGLPQWQY.FTS.GISPQAK.WF.MYKP.TYNTDLLAEETNSFVNKLDPS.VFKSKNKTLIPK...PV.PA.GQKGPPG
Retrocopy
LGLPQWQYTFTSHGISPQAK*WFSMYKPITYNTDLLAEETNSFVNKLDPSEVFKSKNKTLIPKR--PVPPARGQKGPPG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide