RetrogeneDB ID:
retro_mputfur_509
Organism:
Location:
GL896917.1:7462938-7463276 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.35 %
Coverage:
52.29 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
THAP domain containing, apoptosis associated protein 2 [Source:UniProtKB/TrEMBL;Acc:G9KT67]

Genomic region (view in browser)





>retro_mputfur_509
ACCCACAACACACACGTGACCATCAGCCTCCACAGGCTCCCTCTGGATTCTAGAAGAAGA
AAAGAATGGGCTCGCCCACTTAGGTACAACAATTTTGTGCCAGGAAAACACTTTTCTTTG
TTCAAAGCACTTTGAAGTCTCTTGTTCTGACTCAAAGGACAAGCTAGACGACTTACAATG
GATGCAATTCCAACCAGTTTAGGTTTCTGTACCTATTGAAAGTCCATGAAACTCAAGTCA
AGGAATCTTTTGAAGGAAAACAACAGTTGTACTCCAACAGGACCATCTAGTTTAAGATCA
AACGTTAGTAGTCAGCCAGAACTACATAACACAGTTAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TYNKHINISFHRFPLDPKRRKEWIRLLRRKNFVPGKHTFLCSKHFEASCFDLTGQTRRLKMDAVPTIFDFCTHLKSMKLKSRNLLKKNNSCTPTGPSNLK
T.N.H..IS.HR.PLD..RRKEW.R.LR..NFVPGKH.F...K......F.L.GQ.RRL.MDA.PT...FCT..KSMKLKSRNLLK.NNSCTPTGPS.L.
Retrocopy
THNTHVTISLHRLPLDSRRRKEWARPLRYNNFVPGKH-FSLFKAL*SLLF*LKGQARRLTMDAIPTSLGFCTY*KSMKLKSRNLLKENNSCTPTGPSSLR


Parental protein
SNISSQQVLLE-HSY
SN.SSQ..L...HSY
Retrocopy
SNVSSQPELHN/HSY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide