RetrogeneDB ID:
retro_mputfur_511
Organism:
Location:
GL896917.1:9919693-9919994 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
76.47 %
Coverage:
74.26 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
MNF1
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial nucleoid factor 1 [Source:HGNC Symbol;Acc:21237]

Genomic region (view in browser)





>retro_mputfur_511
GTAGCACAGGCCTTTCCGGAGGGAAAGGGTACTCAAGATTGTAGAGCCTGAGGCCTGTGA
TCAGAGGTATGAGAGCTTAGCATGACTCCATTCAAACTATTACAGATATAAGAACCCTCA
CCCCAAAGACATGAGCCTCACTGGCCTGTCCCCAGAGTACAGGCCAATCCTGTCCACAGA
CATCTTGGAAGAGTTTAAGGAAATGAATAAAGAAATGTGGAAGAAACTGCAGGAGAAGTT
TGCTCCCAGGAATCCCAAGGAGAAGCAGAAGGCATGGGCTCAGCCCTTATCTCACCCACG
C


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VAQAFREGENTQ-IAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSVEEYKLILSTDTLEEFKEMNKGMWKKLQEKFAPRNPEEKQKAWARPLSR
VAQAF.EG..TQ.I.EPEACDQ.YESLA.LHSNYY..K.P.P.D.S..GLS..EY..ILSTD.LEEFKEMNK.MWKKLQEKFAPRNP.EKQKAWA.PLS.
Retrocopy
VAQAFPEGKGTQ\IVEPEACDQRYESLA*LHSNYYRYKNPHPKDMSLTGLS-PEYRPILSTDILEEFKEMNKEMWKKLQEKFAPRNPKEKQKAWAQPLSH


Parental protein
PR
PR
Retrocopy
PR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide