RetrogeneDB ID:
retro_mputfur_512
Organism:
Location:
GL896917.1:11953665-11954019 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.41 %
Coverage:
97.44 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
CD59
Parental gene aliases:
No gene alias available
Parental gene description:
CD59 molecule, complement regulatory protein [Source:HGNC Symbol;Acc:1689]

Genomic region (view in browser)





>retro_mputfur_512
ATGGGAAGCAAAGGAGAATTCATCCTGTTTCTGCTTGTCCTGGCTGTCCTCTGCCACTCT
GATCATAGCCTAACATGCTCCATCTGTACTGAACCAGACCATGACTGCAATAAGACCACC
ACTTGTTCAGTTAATCTTGATATGTGTCTTTTTGTCAAAGCTGAGCCAAAACTTGTTTAC
CACCAGGGTTGGAAGTTTGATAATTAAAATTACAAGTATATTTCAAAAGCCCCAGGGCTT
AAGAAGCTTGAGTACTGCTGCTGCCAGCAGGACCTGTGTAACAGAAATGCTGGGGTGAGT
GTCTCCGGGAAGATGGCTCTGCTGGCCACCCCACTGTTAGCAGTAGCCTAGACT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MESKGGFI-FLLILAVLCRSGHSLTCYACIDSE-TCNKTTVCSVNHDACLLVKADPKLFYRQCWKFDDCSYLSISKALGLKKLEYSCCQKDLCNGSA--R
M.SKG.FI.FLL.LAVLC.S.HSLTC..C......CNKTT.CSVN.D.CL.VKA.PKL.Y.Q.WKFD...Y..ISKA.GLKKLEY.CCQ.DLCN..A...
Retrocopy
MGSKGEFILFLLVLAVLCHSDHSLTCSICTEPDHDCNKTTTCSVNLDMCLFVKAEPKLVYHQGWKFDN*NYKYISKAPGLKKLEYCCCQQDLCNRNAGVS


Parental protein
VSGMTALMLFPLLAAALT
VSG..AL...PLLA.A.T
Retrocopy
VSGKMALLATPLLAVA*T


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide