RetrogeneDB ID:
retro_mputfur_514
Organism:
Location:
GL896917.1:16261591-16262064 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
84.28 %
Coverage:
96.93 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RSL24D1
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal L24 domain containing 1 [Source:HGNC Symbol;Acc:18479]

Genomic region (view in browser)





>retro_mputfur_514
GAGAGGTGTCATTTCTCTTCAGGCCCTATGTACTCCAGTCACGGCATGATGTTTGTTCAC
AACGACTGCAAGGTGTTCAGATTCTGTAAATCCAAGTGTCATAAAAACTTTAAAAAGAAG
CAGAATCCTCACAAGTCCAGGTGGACTAAAGCATTCCGTACAGCAGCTGGTAAAGAGCTT
ACAGTGGATAATTTATTTCAATTTGAAAAACGTAGAAATGAACCTGTCAAATACCAGTGA
GAGCTGTGGAATAAAACTATTGTTGCAATGAAGAGAGCTGAAGAGATCAAACAGAAGTGC
CAAGCTAAATTTATAATGAATGGATTAAAGAAAAATAAAGAATTAGAGAAAGTTCAGGAC
ATCAAAGAAGTCAAGCAAAACACTCATCTTATCCGGGACCCTCCTGCAGGCAAAGAAAAG
CACCTGGAAGAAAAATGGTGCAGAAATTACAACAGGATGTGGACATGGAAGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPVKYQRELWNKTIDAMKRVEEIKQKR
E.C.F.SGP.Y..HGMMFV.NDCKVFRFCKSKCHKNFKKK.NP.K.RWTKAFR.AAGKELTVDN.F.FEKRRNEPVKYQ.ELWNKTI.AMKR.EEIKQK.
Retrocopy
ERCHFSSGPMYSSHGMMFVHNDCKVFRFCKSKCHKNFKKKQNPHKSRWTKAFRTAAGKELTVDNLFQFEKRRNEPVKYQ*ELWNKTIVAMKRAEEIKQKC


Parental protein
QAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEE-KMVQKLQQDVDMED
QAKFIMN.LKKNKEL.KVQDIKEVKQN.HLIR.P.AGK.K.LEE.KMVQKLQQDVDMED
Retrocopy
QAKFIMNGLKKNKELEKVQDIKEVKQNTHLIRDPPAGKEKHLEE/KMVQKLQQDVDMED


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide