RetrogeneDB ID:
retro_mputfur_516
Organism:
Location:
GL896917.1:904429-904808 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
57.81 %
Coverage:
97.66 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
Gm11808
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 11808 [Source:MGI Symbol;Acc:MGI:3649356]

Genomic region (view in browser)





>retro_mputfur_516
ATGCAGATCTTTGTGAAAACCCTAGTGGCAAAGACCATCACCCTCGAGGCCAAGCCCAGT
GACAACACTGAAAATGTCAAAAATCCAAGCCAAAATCCAAGACGAGAAGGGCATCACGCA
TGACCAGCAACATCTCATTTTTGCAGACATATAGCTGGACAATGGCCACACTCTCAGACC
ACAATATCCAGAGATATTGTGCATACTGTACTTGGTGCTTCACCTTCGATCTGGCATCAC
CCAGCCTTCCCTCCACCAGCTGGCCCAGAAACCCAACTGTGACAAGATCATCTGCCCTGA
GTGTTCTGCTCACTTGCACCCCCGTATTGTCATCTGCAGTAAGAAATGTGGCCTCACCAA
CAACCAGTGCCCCAAGAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQIFVKTLTGKTITLEVE-PSDTIE--NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICR
MQIFVKTL..KTITLE...P..T.......AKIQD..GI..DQQ.LIFA...L..G.TL..........L.LVL.LR.GI..PSL.QLAQK.NCDK.IC.
Retrocopy
MQIFVKTLVAKTITLEAK\PVTTLKMSKIQAKIQDEKGITHDQQHLIFADI*LDNGHTLRPQYPEILCILYLVLHLRSGITQPSLHQLAQKPNCDKIICP


Parental protein
KCYARLHPRAVNCRKKKCGHTNNLRPKK
.C.A.LHPR.V.C..KKCG.TNN..PKK
Retrocopy
ECSAHLHPRIVIC-SKKCGLTNNQCPKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide