RetrogeneDB ID:
retro_mputfur_517
Organism:
Location:
GL896917.1:3598123-3598433 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
72.64 %
Coverage:
85.25 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
Gm2178
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348]

Genomic region (view in browser)





>retro_mputfur_517
AATACAGTGGCTAACAAAACTAGGTTGTCCTGAACCCCTGGTAATAGAATCATTTACCTT
TATACCAAGAAAGTTGGAAAAACACCCAAATGCACATGTGTTGTGCTCCCAGGTGGACTT
TGAGTAGTTTGTGCTGTGACACCCCAGTTCTTATAAGATCATCTAAAACAAAAAAGACGT
CAGTGGAGCCTGTGAGGGTTCCATGTGTGCTAAGTGTGTTCATGACAGGATCGAGTGTGC
TTTCCTTATTGAGGAGCAGAAAATTGTTGTGAAAGTGTTGAAGGTACAAGTGCGGAGTCA
GAAAGCTAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPK-VLMRLSKT-KKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQA
NT..NKTRLS.TPGNRI.YLYTKKVGK.PK..C.V.PG.L..V.AV.P..VL.R.SKT.KK.VS.A..GSMCAKCV.DRI..AFLIEEQKIVVKVLK.Q.
Retrocopy
NTVANKTRLS*TPGNRIIYLYTKKVGKTPKCTCVVLPGGL*VVCAVTPQ/VLIRSSKT/KKDVSGACEGSMCAKCVHDRIECAFLIEEQKIVVKVLKVQV


Parental protein
QSQKAK
.SQKAK
Retrocopy
RSQKAK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide