RetrogeneDB ID:
retro_mputfur_523
Organism:
Location:
GL896917.1:9282223-9282541 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
70.75 %
Coverage:
67.95 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
CALM1
Parental gene aliases:
No gene alias available
Parental gene description:
calmodulin 1 (phosphorylase kinase, delta) [Source:HGNC Symbol;Acc:1442]

Genomic region (view in browser)





>retro_mputfur_523
AAAGAGCAGAGACAACAATTTGACAAAGACAACAATGGCATCATCCCAACAAAGGAACTT
GGAACTGTCATGAGGTCCCTGGGTCAGAACCCAACAGAAGTCTAACGGCAAGATCTGATC
AATGAGGTGGACGCTGATGGTAATGGCACCATTGACTAACCAGAATTTTTTACTATGTTG
GCTAGAAAAATAAAAGATACAGACAGTGAAGAAGAAATTCATGAGACACTCCCAGTCTTT
GACAAGTATGGCACTGGTTACATCAGTGTAGCAAAACTACCTCATGTCACAACAAACTTG
GCAGAAGAAGTCAATGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNL
KE....FDKD..G.I.TKELGTVMRSLGQNPTE...QD.INEVDADGNGTID.PEF.TM.ARK.KDTDSEEEI.E...VFDK.G.GYIS.A.L.HV.TNL
Retrocopy
KEQRQQFDKDNNGIIPTKELGTVMRSLGQNPTEV*RQDLINEVDADGNGTID*PEFFTMLARKIKDTDSEEEIHETLPVFDKYGTGYISVAKLPHVTTNL


Parental protein
GEKLTD
.E....
Retrocopy
AEEVNE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide