RetrogeneDB ID:
retro_mputfur_524
Organism:
Location:
GL896917.1:9642369-9642669 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
76.47 %
Coverage:
52.63 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
LZIC
Parental gene aliases:
No gene alias available
Parental gene description:
leucine zipper and CTNNBIP1 domain containing [Source:HGNC Symbol;Acc:17497]

Genomic region (view in browser)





>retro_mputfur_524
AACCAGGCCTTTTAAACCCCAGAGGTCATCAGATTACTTGAAAGAAACAAACAGGTCAGC
TTCAGACAAGGTTAGCAGAGATGGATAGAGATCTCGTGGTGGTAAAGCTGGAAAGAGGCC
TCTACTCTCAACAGAAAGGGGGAGATACTAACAGCTCTCAGGACATGTGGAGGGAAGCTG
AGTACAGATGGCGAGGCCTTCTTGTCAGCAAATGCAGCTGCTCTACTTGGCCAGTTTGAG
AAAGTATCTCCAGACCTTGGCTCTGGAGACAAGGTTCTTGCATTGGCAAGCTCTGAGGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SQAFKTPEVIRLFA-KKQPGQLRTRLAEMDRDLMVGKLDRGLYMQQKV-EILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKVLALASF
.QAF.TPEVIRL...KKQ.GQL.TRLAEMDRDL.V.KL.RGLY.QQK..EILTALR..G.KL..D.EAFLSANA.A.L.QFEKVS.DLGSGDKVLALAS.
Retrocopy
NQAF*TPEVIRLLE/KKQTGQLQTRLAEMDRDLVVVKLERGLYSQQKG\EILTALRTCGGKLSTDGEAFLSANAAALLGQFEKVSPDLGSGDKVLALASS


Parental protein
EV
EV
Retrocopy
EV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide