RetrogeneDB ID:
retro_mputfur_525
Organism:
Location:
GL896917.1:12520496-12520865 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
97.58 %
Coverage:
99.2 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS25
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S25 [Source:HGNC Symbol;Acc:10413]

Genomic region (view in browser)





>retro_mputfur_525
CCGCCCAAGGATGACAAGAAGAAGAAGGATGCCAGAAAATCGGCCAAAAAAGACAAAGAC
CCAGTGAACAAATCTGGGGGCAAGGCCAAAAAGAAGTGGTCCAAAGGCAAAGTTCGGGAC
AAGCTGAATAATTTGGTCTTGTTTGACAAAGCGACATATGACAAGCTCTGTAAAGAAGTT
CCCAACTATAAGCTTATAACTCCAGCTGTTGTCTCTGAGAGACTGAAGATTCGAGGTTCC
CTGGCCAGGGCAGCCCTTCAGGAGCTCCTTAGTAAAGGACTTATTAAACTGGTTTCAAAG
CACAGAGCTCAAGTAATTTACACCAGAAACACCAAGGGTGGAGATGGCCCAGCTGCTGGT
GAAGATGCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PPKDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVS
PPKDDKKKKDA.KSAKKDKDPVNKSGGKA.KKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVS
Retrocopy
PPKDDKKKKDARKSAKKDKDPVNKSGGKA-KKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVS


Parental protein
KHRAQVIYTRNTKGGDAPAAGEDA
KHRAQVIYTRNTKGGD.PAAGEDA
Retrocopy
KHRAQVIYTRNTKGGDGPAAGEDA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide