RetrogeneDB ID:
retro_mputfur_541
Organism:
Location:
GL896918.1:10017667-10018045 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.34 %
Coverage:
68.82 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
ARL8B
Parental gene aliases:
No gene alias available
Parental gene description:
ADP-ribosylation factor-like 8B [Source:HGNC Symbol;Acc:25564]

Genomic region (view in browser)





>retro_mputfur_541
GCGCTCATCTCCCGCCTGCTGGACTGGTTTCGCTCGCTCTTCTGGAAGGAGGAGATGGAG
CTGACGCTGGTGGGGCTGCAGTACTCCGGCAAGACCACCTTCGTCAATGTCATCGCGTCA
GGTCAATTCAGTGAAGATATGATACCCATAGTGGGCTTTAACATGAGGAAAGTAACTAAA
GGTAACGTCACAATAAAGATTTGGGACATAGGAGGACAGCCCCAATTCCGAAGCATGTGG
GAACGGTACTGCAGAGGAGTCAATGCCATTGTTTATATGATAGATGCTGCTGATCGTGAA
AAGATAGAAGCCTCTCGAAATAAACTACATAATCTTCTAGATAAGCCACAGTTACAAGGA
ATTCCAGTGCTAGTACTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SLCSGLVDSFRIILFGTFPTLLTLIYRWEMNKFSFIVVIFQSGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAAD
.L.S.L.D.FR..LF......LTL.......K..F..VI..SGQFSEDMIP.VGFNMRKVTKGNVTIKIWDIGGQP.FRSMWERYCRGVNAIVYMIDAAD
Retrocopy
ALISRLLDWFRS-LFWKEEMELTLVGLQYSGKTTFVNVI-ASGQFSEDMIPIVGFNMRKVTKGNVTIKIWDIGGQPQFRSMWERYCRGVNAIVYMIDAAD


Parental protein
REKIEASRNELHNLLDKPQLQGIPVLVL
REKIEASRN.LHNLLDKPQLQGIPVLVL
Retrocopy
REKIEASRNKLHNLLDKPQLQGIPVLVL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide