RetrogeneDB ID:
retro_mputfur_545
Organism:
Location:
GL896919.1:830801-831263 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
85.71 %
Coverage:
74.04 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL7
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L7 [Source:HGNC Symbol;Acc:10363]

Genomic region (view in browser)





>retro_mputfur_545
ACTGAAATTTGAATGGCGAGGATGGCAAGAAAGGCTGGCAACTTCTACATATCTGTGGAA
CCCAAATTGACATTTGTCATCAGGATCAGAGGTATTAATGGTGTGACCCCAAAGGTTCGA
AAGGTGTTGCAGCTTCTTCACCTTTGCCAAATCTTCAATGGCTCCTTTGTTAAGCTCAAC
AAGGCTTCAGTTAACATATTAAGGATTGTGGAACCATATATAGCATGGGGATACCCAAAC
CTGATGTTGGTGAATGAATTGATCTACAAGCATAGTTATGGCAAAATCAACAGGAAGCAA
ATTGCCCTGACAGATAACACATTGATTGCCTGATCTCTAGGTAAATATGGCATCATCTTC
AGGGAGGATCTGATTCATGAGATCTATACTGTTGGAAAACATTTCAAAGAGGCAAATGAC
TTTTTATGGCCCTTCAAATTATCTTCTCCACGAGGGGCAATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKR
TEI.MARMARKAGNFY...EPKL.FVIRIRGINGV.PKVRKVLQLL.L.QIFNG.FVKLNKASVN.LRIVEPYIAWGYPNL..VNELIYK..YGKIN.K.
Retrocopy
TEI*MARMARKAGNFYISVEPKLTFVIRIRGINGVTPKVRKVLQLLHLCQIFNGSFVKLNKASVNILRIVEPYIAWGYPNLMLVNELIYKHSYGKINRKQ


Parental protein
IALTDNTLIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGM
IALTDNTLIA.SLGKYGII..EDLIHEIYTVGK.FKEAN.FLWPFKLSSPRG.M
Retrocopy
IALTDNTLIA*SLGKYGIIFREDLIHEIYTVGKHFKEANDFLWPFKLSSPRGAM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide